KEGG   Yersinia ruckeri YRB: BD65_622Help
Entry
BD65_622          CDS       T03611                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
yru  Yersinia ruckeri YRB
Pathway
yru00250  Alanine, aspartate and glutamate metabolism
yru00410  beta-Alanine metabolism
yru00430  Taurine and hypotaurine metabolism
yru00650  Butanoate metabolism
yru01100  Metabolic pathways
yru01110  Biosynthesis of secondary metabolites
yru01120  Microbial metabolism in diverse environments
yru02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:yru00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BD65_622
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BD65_622
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BD65_622
   00430 Taurine and hypotaurine metabolism
    BD65_622
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    BD65_622
Enzymes [BR:yru01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BD65_622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC PRTase_3
Motif
Other DBs
NCBI-ProteinID: AJI94043
LinkDB All DBs
Position
669663..671066
Genome map
AA seq 467 aa AA seqDB search
MTKKNDTNDFRSTLLDSRFGSESIRNIAESKRFPEKEIREDVAFQIINDELFLDGNARQN
LATFCQTWDDDNVHKLMDLSINKNWIDKEEYPQSAAIDMRCVNMVADLWNAPKQKNGQAV
GTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTNKPNFVCGPVQVCWHKFARYWDVEIRE
LPMEPGQLFMDPQRMIEACDENTIGVVPTFGVTYTGNYEFPKPLHDALDKLQRETGLDID
MHIDAASGGFLAPFVAPDIEWDFRLPRVKSISTSGHKFGLAPLGCGWVIWRDEASLPEEL
VFKVDYLGGQVGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQSASYQVAAFLAEEIAK
LDSYEFICSGGVEEGIPAVCFRVKEGAKPGYTLYDLSERLRLRGWQVPAFALNGGMSDVV
VMRIMCRRGFEMDFAELLLEDFKSSLNYLSQHPSLGGLASQNSFKHT
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgactaagaaaaatgataccaatgattttcgctcgacacttctagactctcgcttcggt
tctgaatctattcgtaatatagcagaaagcaaacgtttccctgaaaaagagatacgcgaa
gatgtggcttttcaaattattaatgacgaattatttctcgatggaaatgcacggcagaac
ttagcgacgttttgccaaacgtgggatgacgataacgttcataagctgatggatctctca
atcaataaaaactggattgataaagaggaatatcctcagtctgcagccattgatatgcgt
tgtgtcaatatggtcgccgatctgtggaatgcaccaaagcagaaaaatggtcaggccgtt
ggtaccaacaccatcgggtcttcagaagcctgcatgctcggtggaatggcgatgaaatgg
cgttggcgtaaacgcatggaagccgccggtaaacctaccaataagccaaactttgtttgc
ggccctgttcaggtttgctggcataaatttgcacgctattgggacgtcgaaatacgtgaa
cttccaatggagccaggccaactatttatggatcctcagcgaatgattgaggcttgtgat
gaaaataccatcggggtagtgccaacctttggtgtaacttacacgggtaattatgagttt
cctaaaccacttcatgatgcgttagacaaattgcaacgcgagacgggtttagacattgat
atgcatatcgatgcagccagtggtggctttttagcaccttttgttgccccggatatcgag
tgggatttccgtttaccgcgcgtgaagtctatcagtacttcaggccataagtttggtctg
gctcctctgggctgcggttgggttatttggcgtgatgaagcgtcactacctgaagagttg
gtattcaaggtcgattatctgggtggacaggtggggacattcgctatcaatttttctcgt
ccagcgggacaagttattgctcaatattatgagtttttacgcttgggtcgtgaaggttat
accaaagtacaaagtgcctcttatcaggttgccgccttcttggcagaagaaattgccaaa
ttagattcttatgaatttatctgttccggtggtgtcgaggaaggtattcctgcggtttgc
ttccgcgtaaaagaaggcgcaaaacctggttataccttgtatgacctatctgaacgttta
aggctgcgcggttggcaagtacccgcgtttgccctaaacggtgggatgtctgatgtcgtt
gtgatgcgtattatgtgccgacgtggcttcgaaatggactttgccgaattattattagaa
gactttaaatcctcgctgaactacttaagccagcacccatcgctgggtggattggcgagc
caaaatagttttaaacatacataa

DBGET integrated database retrieval system