KEGG   Zhongshania aliphaticivorans: AZF00_10720Help
Entry
AZF00_10720       CDS       T04315                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  
malate dehydrogenase [EC:1.1.1.37]
Organism
zal  Zhongshania aliphaticivorans
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:zal00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AZF00_10720
   00620 Pyruvate metabolism
    AZF00_10720
   00630 Glyoxylate and dicarboxylate metabolism
    AZF00_10720
  Energy metabolism
   00680 Methane metabolism
    AZF00_10720
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AZF00_10720
Enzymes [BR:zal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     AZF00_10720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2411607..2412587
Genome map
AA seq 326 aa AA seqDB search
MKQPVRVTVTGAAGQIGYALLFRIASGAMLGDDQPVILHLLDITPAMDALQGVRMELEDC
AFPLLAGVVCTDDPNVGFKDADYALLVGARPRGPGMERKDLLEANAAIFSVQGKAIDQNA
SKNIKVLVVGNPANTNALIAQRNAPSISPRNFTAMTRLDHNRAMTQIAIKTGKTVNDVTN
MTIWGNHSATQYPDLFNAKVSGQTASDLVDQAWLEGDFIPTVQQRGAAIIKARGASSAAS
AANAAIGHVRSWALGTEGDDWVSMGVYSDGSYGIAEGLIYSFPCRCKDGEWEIVQGLEVN
DFSRAKMQASEQELAEERDGVKHLLP
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaccagttcgcgtcaccgttaccggtgcagccggccaaattggctacgcttta
cttttccgcatcgcctctggcgctatgctgggcgacgatcagcccgttattttacaccta
ctcgacatcactccagccatggacgccctgcaaggcgtgcgcatggaactggaagattgc
gccttcccattattggctggcgtagtttgcaccgacgatccaaatgttggctttaaagat
gccgactacgccctgctggttggcgcacgtccacgtggcccaggcatggagcgtaaagac
ttgcttgaagctaacgcggcaatcttctctgttcaaggtaaagccattgaccagaatgcc
agcaagaacatcaaagtattggttgttggcaaccccgctaacaccaacgccctgatcgcc
cagcgcaacgcgccgtctatcagcccacgcaacttcactgccatgacgcgcttggatcac
aaccgcgccatgactcagattgccatcaaaaccggcaaaactgtgaacgacgtgaccaac
atgaccatttggggcaaccactctgctactcagtacccagacctgttcaacgccaaggtc
tctggccagactgcaagtgacttggttgaccaagcgtggctcgaaggcgatttcatcccg
actgttcagcagcgcggtgcagcaatcatcaaagcccgtggcgcttcttctgctgcttct
gcggctaacgctgcaatcggtcacgtgcgcagctgggcactgggcaccgaaggcgacgac
tgggtttctatgggtgtttacagtgacggcagctacggcattgccgaaggcctgatctac
tcattcccttgccgctgcaaagatggcgagtgggaaattgttcaaggtcttgaagttaac
gacttcagccgcgcaaaaatgcaagcttctgagcaagaactggccgaagagcgcgacggc
gtaaaacacttacttccttaa

DBGET integrated database retrieval system