KEGG   Zobellella denitrificans: AN401_09135Help
Entry
AN401_09135       CDS       T05100                                 

Definition
(GenBank) hypothetical protein
Organism
zdf  Zobellella denitrificans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Acyltransferase PP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ATG75878
UniProt: A0A291HV03
LinkDB All DBs
Position
1964505..1967339
Genome map
AA seq 944 aa AA seqDB search
MQDEDDSPQPDGARAQQLLALVDQTLRDLQPEAPAMPPARLDSSLDRDLALDSLARMELL
LRIEQAFAVDLPEDTLQRADTVRDLLLAIEQAPSADAARVSRRRPLGDLSRPAPVADERG
LLAATTLPEVLDWHERAHPQQVQSILVTDESEQRLSYGELAAGSRGVAAALQQAGVEPGQ
RVAIMLPTSLAYFHCYFGILRMGAIPVPIYPPARASQLEDHVLRHAGILANAAVVLMITV
SEAMVVGRLLQARVSSLRRLATPEQLVAPADGLRPVDIRGEDTAFIQYTSGSTGNPKGVV
LSHANLLANIRAMQGVLAASPRDVFVSWLPLYHDMGLIGAFLGSLYVGLPLVVMSPLTFL
ARPERWLWAIHRYRGTLSAAPNFAYELCLKRIEPAALEGLDLGSWRLACNGAEAVSPDTL
RSFAERFSPYGLKPEAITPVYGLAEASVGLLFPPLGRGPLIDNVRREPLAREHRALPAAE
GDESAQRFVSCGAPLPGHAIRIVDEAGREVGERIEGRLEFRGPSATRGYFRNPAATAGLF
HDGWLDTGDRAYVAAGEVYLTGRVKDMIIRGGRNLYPQEIEEAVVAVEGVRKGGVAVFGS
PDPATGTERLVVLAETRLAGSALAALHGAVVDAVLKVLGEPPDEVVLAPPRTVLKTSSGK
VRRAACRSRYLQGDVGQVAPTARVQLLRLGVGSAALWLRRLGGKLVRAAFALHAMLMLGL
LAPPVWLATLATPSPASAWRLGGRAARWLLRLTGIPFRVEGVDRLPAGPCVLVCNHASYL
DGLLLVAALPRPYAFVAKQELRDQLVAGSYLKKLGVAFVERFELRRSVEDANRLAGLVRG
GGSLLVFPEGTFVARPGLLPFHLGGFLAAAGAAVPVVPVVIRGSRWVLPAERWWPRHGAL
EVEVGAPLPPRQEDEDVFAAAVRLRQAARAWIAQQLATTEQEEE
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagacgaagacgacagcccccaacccgacggcgcccgcgcgcaacaactgctcgcg
ctggtcgaccagaccctgcgcgatctgcagccggaagccccggcgatgccgcccgcccgg
ctcgacagttccctggaccgggatctggccctcgacagcctggcgcggatggagctgctg
ctgcgtatcgagcaggctttcgcggtcgacctgccggaagacaccctgcagcgggcagac
acggtgcgggatctgctgctcgccatcgagcaggcgccaagcgccgacgcggcccgggtc
agccggcgccgccccctgggcgacctctcccgcccggccccggtggcggacgagcggggg
ctgctggccgccaccaccctgccggaggtgctcgactggcatgagcgggcccacccgcag
caggtacagagcatcctggtcaccgacgaatccgagcaacggctcagttacggcgagctg
gcggccggcagccggggggtggcggccgccctgcagcaggccggggtcgagccgggccag
cgggtggccatcatgctgcccacctccctcgcctacttccactgctacttcggcatcctg
aggatgggcgccatcccggtgcccatctatccgccggcgcgggcctcccagctcgaagac
catgtgttgcgccatgccggcatcctcgccaacgccgccgtggtgctgatgatcaccgtg
tccgaggccatggtggtgggccgcctgctgcaggcccgggtgagcagcctgcgccggctg
gccacccccgagcagttggtcgcgccggcggacggcctgcgcccggtcgacattcgcggc
gaggacaccgcctttatccagtacacctcgggcagcaccggcaaccccaagggggtggtg
ctgagccacgccaacctgctcgccaacatccgcgccatgcagggggtgctggcggccagc
ccgcgcgacgtcttcgtcagctggctgccgctctaccacgacatggggctgatcggcgcc
tttctcggcagcctctatgtgggcctgccgctggtggtgatgtcgcccctcacctttctg
gccaggccggagcgctggctgtgggccatccaccgctatcgcggcaccctctcggcggcc
cccaacttcgcctacgaactctgtctcaagcgcatcgagccggcggcgctggagggactg
gatctcggcagctggcggctggcctgcaacggcgccgaggcggtcagccccgacaccctg
cgcagctttgccgagcggttctccccctatggcctgaagcccgaagccatcacccccgtc
tacggcctggccgaggcgtcggtcggcctgctgttccccccgctcgggcgcggcccgctg
atcgacaatgtccggcgcgaacccctggcacgggaacaccgtgccctgcccgccgccgag
ggggacgagagcgcccagcgcttcgtgtcctgcggggcgcccctgcccggccatgccatc
cgcatcgtcgacgaggccggccgggaggtgggcgagcgcatcgagggccggctggagttc
aggggcccttcggccacccggggctacttccgcaatcccgcggccaccgccgggctgttc
cacgatggctggctcgacaccggcgatcgcgcctatgtcgccgccggcgaggtctacctc
accgggcgggtgaaggacatgatcatccgcggcggccgcaacctctatccccaggaaatc
gaggaggcggtcgtcgccgtcgagggggtgcgcaagggcggggtggcggtgttcggcagc
ccggatccggccaccggcaccgagcgcctggtggtgctggccgaaacccgactggccggt
agcgccctcgccgccctgcatggggccgtggtggatgccgtgctgaaggtgctgggcgag
ccgcccgacgaggtggtgctggccccgccccgcaccgtgctcaagacctccagcggcaag
gtgcgccgtgccgcctgccgcagccgctatctgcagggagacgtcggccaggtcgcgccc
acggcccgggtacaactgctgcgcttaggggtaggcagcgccgcgctctggttgcgccgc
ctgggcgggaaactggttcgtgccgccttcgccctgcatgccatgctgatgctcggactg
ctggctccccctgtctggctggcgaccctcgccacgccatcgcccgcctcggcctggcgc
ctgggcggccgggcggcccgctggctgctgcgcctgaccggcatccccttcagggtggaa
ggcgtggatcggctgccggcgggcccctgcgtgctggtgtgcaaccacgccagctacctg
gatggcctcttgctggtggcggccctgccccggccctacgccttcgtcgccaaacaggaa
ctgcgcgaccagctcgtcgcgggtagctacctgaagaagctgggggtggccttcgtcgag
cgcttcgaactgcggcgcagcgtggaggacgccaaccgcctggccgggctggtcaggggc
gggggctcgctgctggtgttcccggaggggaccttcgtcgcccgcccggggctcctgccc
ttccacctgggcggttttctcgccgccgccggcgcggccgtgccggtggtgccggtggtg
atccgcggcagccgatgggtgctgcccgccgaacgctggtggccccggcacggcgccctg
gaggtggaagtgggcgcccccctgccgccccggcaagaggacgaggacgtgttcgcggcg
gcagtgcggctccggcaggcggcccgcgcctggatcgcccagcagttggcaacgacagag
caggaggaggaataa

DBGET integrated database retrieval system