KEGG   Zobellia galactanivorans: ZOBELLIA_676Help
Entry
ZOBELLIA_676      CDS       T01586                                 

Gene name
ppcA
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
zga  Zobellia galactanivorans
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:zga00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ZOBELLIA_676 (ppcA)
  Energy metabolism
   00680 Methane metabolism
    ZOBELLIA_676 (ppcA)
Enzymes [BR:zga01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ZOBELLIA_676 (ppcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(829862..832408)
Genome map
AA seq 848 aa AA seqDB search
MPHIERLVEFKKSVNNKFNVYNSLFLNLPYRNIENVGMLIPLLLDQCQKGLGSGLNPQEI
LEKFFENYAHIDSEKEQIDFMFKIIQYVERQVVLYDSVEDAAFPKLQEHTQSLSIKDYFQ
LVNKNKSWDKVSKKLSSFSARLVLTAHPTQFYTPAVLDIIEELRSLILEDKIDDIDITLQ
QLGLTSLINSKKPTPLDEAKNIIYFLRHVYYNAVGDLYAYIKENIKKDDFENHNIMKLGF
WPGGDRDGNPFVTADITKDVADELRINLMKCYYNDLKIIQKKLTFKDLQEPIQKLRGNLY
TAMFDSKKTVGYNDILQPLLDIKELLINKYHSLYLKELENFIDKVKIFKTHFATLDVRQD
HSKHKLATESILKNNKLIKESVDELSEEALVDLLINKDLKVNASDYSEDIVKDTITNIKQ
LKSIQDANGEEGCNRYIISNSEDIFSVLFVFGLFRWCGWKKEEITFDIVPLFETMNGMEG
AEKTMQTLFDLPDYKAHLERRNHNQTIMLGFSDGTKDGGYLKANWAIFKTKETLSKVCDK
NGFNAIFFDGRGGPPARGGGKTHRFYAAQTKSIANHEIQLTIQGQTITSTYGTKEQFIHN
SEQLLTAGLSNNLFGKENVISKEHRKLIEQLSELSFKKYDALKNHDKFIPYLENRSTLKY
YQKANIGSRPGKRGNKKKLELTDLRAISFVGSWSQLKQNVPGYFGIGTAIQTIKNEGRLS
ELKKLYKEVPFFKALMHNSMMSLSKCYFELTSYMQKDEEYGDFWNILHEEYQLSKKMLLL
ISGSKILMENEAVSRESIKIRENIVLPLLVIQQFALQRIGQDTSFKDEYEKIVTRSLYGN
INASRNSA
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atgccgcatatagaaagattggttgagtttaagaagtcggtcaacaacaagtttaatgtc
tacaatagtctgttcttgaatttgccgtatcgcaatatcgagaacgtgggtatgcttata
ccattgttgttggatcaatgtcagaaaggattgggttcaggacttaacccccaggaaatt
cttgaaaagttctttgagaactacgcgcatatcgattctgaaaaagaacagatcgatttt
atgttcaagattattcagtacgttgagcgacaggtggttttgtacgatagtgttgaagat
gcagcttttccgaagctacaagagcatacacagtcgttatcgatcaaagactactttcaa
ttggtaaataagaacaagagttgggacaaggtgtctaaaaaactttcttcgttcagtgcc
cgccttgtgttaacggcccatcctacacagttttataccccggccgtactcgatatcatc
gaagaattgcgatcgcttattttagaggataagatagacgatattgatattaccttacag
cagttggggctgacttctttgatcaattcaaaaaaacctaccccattggatgaagctaaa
aatatcatttactttttacgccatgtgtattacaatgccgtaggggacttgtatgcttat
atcaaagaaaatataaaaaaggacgacttcgagaatcacaatattatgaagttgggcttt
tggcccggtggtgaccgtgacggaaacccttttgtaacggccgatattacaaaagacgtg
gccgatgagcttcgtatcaatttgatgaagtgttactacaatgatttgaagatcattcag
aaaaaattgaccttcaaagatttgcaggagcctatccaaaaactccgtggcaacttgtat
accgccatgttcgattcaaagaaaaccgtgggctataacgatatcttgcaaccacttctt
gatattaaggagttgttgatcaataaatatcacagcctttacttaaaggaattggagaac
tttatcgataaggtgaagatattcaagacccattttgccaccttggatgtcagacaagat
catagcaagcacaaattggcgaccgagagtatattgaagaacaataaactgatcaaagaa
agtgttgacgagctttcagaagaagccttggtcgatcttttgatcaataaagaccttaag
gtcaatgccagtgattattccgaggatatcgttaaagataccatcaccaacatcaagcag
ttgaagagtattcaagatgccaatggggaagagggatgcaatcgctatatcatcagtaat
tcggaagatattttttcggtactgttcgtttttggactgttccgatggtgcgggtggaag
aaagaagagatcactttcgatatcgtacccttgttcgagaccatgaacggtatggaaggg
gccgaaaaaaccatgcaaacgcttttcgatttacccgattataaggcgcatcttgaaaga
agaaatcacaaccagaccattatgctcggtttttccgatggtacaaaagatggtggatat
ttaaaggccaactgggctattttcaagaccaaggaaaccttgtccaaggtgtgtgataaa
aatggcttcaacgctattttctttgacggacgtggtggcccaccggcacgtggtggtggt
aaaacgcaccgcttttatgcggcccagaccaagagcattgccaatcatgaaatacagttg
accattcaaggacagaccataaccagtacctatggtaccaaggagcagtttatccataac
agtgagcaactcttgacggccggtctttcaaacaaccttttcggtaaagagaacgtgatt
tcaaaagagcacagaaaattgatagagcaactttctgagttgagcttcaaaaagtacgat
gcacttaagaaccatgataaattcattccctacttggagaaccgtagtacgttaaagtac
tatcagaaagccaatataggtagtagaccggggaaaaggggcaataagaaaaaattggaa
cttaccgatcttagggccatctcttttgttggttcttggagccaattgaaacagaacgta
ccgggttattttggtattggtaccgctatacagaccattaaaaatgaaggtaggttgtct
gaacttaagaaattgtacaaagaggtgcctttctttaaagccttgatgcacaatagtatg
atgtcgttgtccaagtgttattttgagctcacatcctatatgcagaaagatgaggagtac
ggagatttttggaacatccttcatgaagagtaccaactgtctaagaaaatgttgcttttg
atttccggaagcaagattttgatggaaaacgaggcagtttcccgtgagtcgataaaaata
cgtgagaatattgttcttccgctcttggtaatccaacagtttgccttgcagagaataggg
caagacacgagctttaaggacgagtacgaaaaaatcgtaacgcgttcgctctacggcaat
attaacgcgagtagaaactcggcgtaa

DBGET integrated database retrieval system