KEGG   Ziziphus jujuba (Chinese jujube): 107412106Help
Entry
107412106         CDS       T04794                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: superoxide dismutase [Cu-Zn]
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:zju00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    107412106
Enzymes [BR:zju01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     107412106
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
2
AA seq 160 aa AA seqDB search
MVKAVAVLGSNEGVSGTIYFAQEGDGPTTVTGNVSGLKPGLHGFHVHALGDTTNGCMSTG
PHFNPASKEHGAPEDENRHAGDLGNVTAGDDGTVSFTIVDKQIPLTGVHSIIGRAVQFFN
VVXSVXCNRHFFXYPGGHELSKSTGNAGGRVACGIIGLQG
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggctgttgccgtgcttggctccaatgagggtgttagtggaactatatacttc
gcccaggaaggagatgggccaactacagtgactggaaatgtttctggcctgaagcctgga
cttcatggtttccatgtccatgctctcggtgatacaaccaatggttgcatgtcaactgga
ccacattttaatcctgctagcaaagaacatggtgcacctgaggatgagaatcgtcatgct
ggtgatctgggaaatgtcaccgctggtgatgatggaactgttagtttcacaattgttgac
aagcagattcctctcaccggagtacactccatcattggtcgggctgttcagttctttaat
gttgtttagtccgtctaatgcaatcgacatttcttttaatacccaggtggacatgagctc
agcaaatccactggaaatgctggtggcagagtagcttgtggtattattggtcttcagggc
taa

DBGET integrated database retrieval system