KEGG   Ziziphus jujuba (Chinese jujube): 27963855Help
Entry
27963855          CDS       T04794                                 

Gene name
rbcL, A9277_gp061
Definition
(RefSeq) ribulose 1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
zju  Ziziphus jujuba (Chinese jujube)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:zju00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    27963855 (rbcL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    27963855 (rbcL)
Enzymes [BR:zju01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     27963855 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
CP
AA seq 475 aa AA seqDB search
MSPQTETKASVGFKAGVKDYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYGLEPVAGEENQYIAYVAYPLDLFEEGSVTNMFTSI
VGNVFGFKALRALRLEDLRIPTSYTKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEALYKAQAETGEIKGHYL
NATAGTCEDMMKRAVFARELGVPIVMHDYLTGGFTANTTLAHYCRDNGLLLHIHRAMHAV
IDRQKNHGMHFRVLAKALRLSGGDHIHAGTVVGKLEGERDITLGFVDLLRDDFIEKDRSR
GIYFTQDWVSLPGVIPVASGGIHVWHMPALTEIFGDDAVLQFGGGTLGHPWGNAPGAVAN
RVALEACVQARNEGRDLAREGNEIIREASKWSPELAAACEVWKEIKFEFEAMDTL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccacaaacagagactaaagcaagtgttggattcaaagccggtgttaaagattat
aaattgacttattacactcctgaatatgaaaccaaagatactgatatcttggcagcgttt
cgagtaactcctcaacctggagttccgcctgaggaagcaggggccgcggtagctgctgaa
tcttctactggtacatggacaactgtatggactgacgggcttaccagtcttgatcgttac
aaaggtcgatgctacggccttgagcccgttgctggagaagaaaatcaatatattgcttat
gtagcttaccccttagacctttttgaagaaggttctgttactaacatgtttacttccatt
gtgggtaatgtttttgggttcaaggccctgcgcgctctacgtttggaggatttgcgaatc
cctacttcttatactaaaactttccaaggaccgcctcatggcatccaggttgaaagagat
aaattgaacaagtatggtcgccccctattgggatgtactattaaacctaaattggggtta
tctgctaagaattacggtagagcagtttatgaatgtcttcgcggtggacttgattttacc
aaagatgatgagaacgtgaattcccaaccatttatgcgttggagagaccgtttcttattt
tgtgccgaagccctttataaagcacaggctgaaacaggtgaaatcaaagggcattacttg
aatgctactgcaggtacatgcgaagacatgatgaaaagggctgtatttgccagagaattg
ggagttcctattgtaatgcacgattacttaacagggggattcactgcaaatactaccttg
gctcattattgccgagataatggtctacttcttcacatccaccgtgcaatgcatgcagtt
attgatagacagaaaaatcatggtatgcactttcgtgtactagctaaagcgttacgtctg
tctggtggagatcatattcacgctggtactgtagtaggtaaacttgaaggggaaagagac
atcactttaggctttgttgatttactacgcgatgattttattgaaaaagatcgaagccgc
ggtatttatttcacgcaagattgggtctctctaccaggtgttatccctgtggcttcaggg
ggtattcatgtttggcatatgcccgctctgaccgagatctttggagatgatgccgtacta
cagttcggcggaggaactttaggacacccttggggaaatgcgcccggtgccgtagctaat
cgagtagctctagaagcatgtgtacaagctcgtaatgagggacgtgatcttgctcgtgag
ggtaatgaaattatccgtgaggctagtaaatggagtcctgaactagctgctgcttgtgaa
gtatggaaggagatcaaatttgaattcgaagcaatggatactttgtaa

DBGET integrated database retrieval system