KEGG   Zea mays (maize): 100277470Help
Entry
100277470         CDS       T01088                                 

Definition
(RefSeq) uncharacterized protein LOC100277470
  KO
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
zma  Zea mays (maize)
Brite
Enzymes [BR:zma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100277470
Chromosome [BR:zma03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class IV HDACs
     100277470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
9
AA seq 351 aa AA seqDB search
MASSSSSPAPALAGEALRQKRILSSKLYLEVPSSKAPVVYSPAYDISFLGLEKLHPFESA
KWGRICRYLTREGYLDKKQMVEPLEACKEDLLVVHTEAYLNSLKCSFRVSSIVEVPPVSL
VPNWIVHRKLLHPFRKQVGGSILSAKLAFERGWAINVGGGFHHCSADEGGGFCAYADISL
CIQFAFVRLNISSVLIIDLDAHQGNGHEKDFANDGRVYILDMYNAGIYPFDFTAKQYIDQ
KVELVSGSKTDEYLEQLDKALEICNSRFEPQLIVYNAGTDILDGDPLGRLKVSPEGVVTR
DDKVFRFAKDRNIPLLMLTSGGYMKSSARVIADSIINLSNKNLIGLGSQLG
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggcctcctcctcctcctcacctgcgcccgccctggccggggaggcgctacgccagaaa
cgcatcctctccagcaagctctacctcgaggtcccgtcctccaaggcgccggtggtttac
tcgccggcatacgacatctccttcctcggccttgagaagctgcacccgtttgaatccgcc
aaatggggccgcatctgtaggtacctcaccagggaagggtacctcgacaagaaacagatg
gtggagccattggaagcctgcaaggaggatttgctagtggtgcacacggaggcgtatttg
aacagtctcaaatgcagcttcagagtttcctccattgtagaggtccctcctgtgtcgctt
gtccctaattggattgtgcacagaaagctactacaccccttccggaagcaggtgggtggg
tccattttatcagccaaacttgcatttgagagaggttgggctattaatgttggtggagga
tttcaccattgttcagcagatgaagggggtggattttgtgcatacgctgacatctctctc
tgcatccagtttgcttttgtccgtctaaatatctcaagtgtattgatcatagacctggat
gcccaccaaggaaatggacacgaaaaagattttgctaatgatggaagggtttacatttta
gacatgtacaatgctggaatttatccctttgatttcactgctaagcaatacattgatcaa
aaagttgaattagttagtgggtcaaaaacagatgaatacttggagcaacttgacaaggct
ctcgagatctgcaatagtagatttgagccccagttgattgtttacaatgctggaacagac
atcctcgatggcgatccgttgggcagattgaaggtaagtcctgagggtgtggttaccaga
gatgataaggtatttaggttcgcaaaagatcggaacattcctttgctcatgctgacatca
ggaggctacatgaagtcaagtgctcgagtaatagctgattcgatcatcaatctgtccaat
aaaaacttgataggattaggcagccagctgggttga

DBGET integrated database retrieval system