KEGG   Zea mays (maize): 100284394Help
Entry
100284394         CDS       T01088                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
zma  Zea mays (maize)
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    100284394
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100284394
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100284394
   00430 Taurine and hypotaurine metabolism
    100284394
Enzymes [BR:zma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     100284394
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1
AA seq 499 aa AA seqDB search
MVVSVAATGPGTDAEPVSSTFFASRYVRDPLPRYRMPERSIPREAAQQIISDELMLDGNP
RLNLASFVTTWMEPECDKLIMDSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPIKEDE
TAIGVGTVGSSEAIMLAGLAFKRKWQNKRKEQGKPCDRPNIVTGANVQVCWEKFARYFEV
ELKEVKLSEGYYVMDPVKAVEMVDENTICVAAILGSTLTGEFEDVKQLNDLLTEKNKETG
WDVPIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYPGVGWVIWRSKDDL
PEELIFHINYLGTDQPTFTLNFSKGSCQIIAQYYQLIRLGFEGYRNIMENCQENAAILRE
GIAATGRFDVLSKDAGVPLVAFSLRDSSRFSVFDVSENLRRFGWIVPAYTMPADAEHVAV
LRVVVREDFSRSLAERLVSDVRKILRELDARATHAVRVATATAEQSGDGVVAKKSVLEIE
REVAARWMNAVNKKKTGVC
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggtggttagcgtggccgcgaccgggcccggcacggacgccgagccggtgagctccacc
ttcttcgcgtcccgctacgtccgcgacccactcccacggtaccggatgccggagcggtcg
atcccgcgggaggcggcgcagcagatcatcagcgacgagctcatgctggacggcaacccg
cgcctgaacctggcgtccttcgtcaccacgtggatggagcccgagtgcgacaagctcatc
atggactccatcaacaagaactacgtcgacatggacgagtaccccgtcaccactgagctc
cagaaccgctgcgtaaacatgatagctcacctgttcaacgcgccgatcaaggaggacgag
acagctattggggtcggaacagtgggatcctcggaagcgatcatgcttgcaggtctggcg
ttcaagaggaaatggcagaacaagaggaaggagcaggggaaaccgtgtgacagacccaac
atcgtcaccggtgccaacgttcaggtctgctgggagaagtttgcaaggtattttgaggtg
gagctgaaggaggttaagctatcagaagggtactacgtcatggaccccgtcaaggctgtt
gagatggtggacgagaacactatctgtgtcgcggcgatcttggggtcgactctcaccgga
gagttcgaggatgtcaagcagttgaacgaccttcttacagagaagaacaaggaaactggg
tgggacgtgcctatccacgtcgacgccgcgagcggagggttcatagcgcctttcctctac
cctgagctcgagtgggacttcaggctgcctctggtgaagagcatcaatgtcagcgggcac
aagtacggcctcgtctaccctggtgttggctgggtcatctggcggagcaaggatgatctg
cctgaggagctcatcttccatatcaactacctggggacggaccagcctacgttcacgctc
aacttctccaaaggttcctgtcagatcattgcgcagtactatcaactcattcgcctaggc
ttcgaggggtacagaaacatcatggagaactgccaggagaacgcggcgatactgcgggag
ggcatcgcggcgacgggccggttcgacgtcctgtccaaggacgccggggtgccgctggtg
gccttctcgctcagggacagcagccggttcagcgtgttcgacgtctccgagaacctgcgg
cggttcggctggatcgtgccggcgtacacgatgccggccgacgcggagcacgtggcggtg
ctccgagtcgtcgtcagggaggacttcagccgcagcctcgccgaacggctggtctcggac
gtccgcaagatcctgcgcgagctggacgcgcgcgcgacccacgccgtgagggtcgccacc
gccaccgccgagcagtcgggcgacggcgtcgtggccaagaaaagcgtgctggagatcgag
cgggaggtcgccgcgcgctggatgaacgccgtgaacaagaagaagacgggggtctgttga

DBGET integrated database retrieval system