KEGG   Zea mays (maize): 103647308Help
Entry
103647308         CDS       T01088                                 

Definition
(RefSeq) histone-lysine N-methyltransferase family member SUVH2
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
zma  Zea mays (maize)
Pathway
zma00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    103647308
Enzymes [BR:zma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103647308
Chromosome and associated proteins [BR:zma03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103647308
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAD_SRA Pre-SET SET
Motif
Other DBs
NCBI-GeneID: 103647308
NCBI-ProteinID: XP_008670073
LinkDB All DBs
Position
2
AA seq 711 aa AA seqDB search
MPREGLGNFGAEEEARDGGQEGLVTEMDVEESSPSSSPMSSPAGSSDSIDLNFLPFLKRE
PKSEPSSPELGPLPLPVSLTQTPPQQHAAAAAPATEASVPPPPATPDLSSASMMTPLQSL
PPNPDEDSLLREYYRLARLYLSSAGSGAIVPTPAPEAAAPAVVQSGAGSVVKKRRPRSSE
LVRVSSLGVQDQIYFRDLVRRARITFECLRGLLLRDDERAESLGLAGAAGFGVARDRRRA
RADMRAAALMADHDLWLNRDRRIVGPMPGISVGDAFFFRMELCVLGLHGQVQAGIDYVSA
GRSASGEPIATSIIVSGGYEDDDDHGDVLVYTGHGGRDPNLHKHCVDQKLEGGNLALERS
MAYGIEIRVIRAVKSRRSPIGKVYFYDGLYKVVDYWLDRGKSGFGVYKYKMLRIEGQEPM
GTVNYRAAEQLKVDVFAVRPTGYFSFDISMGRETLPVALYNDVDDDQDPLLFEYLTRPIF
PTSAVQGKFAEGGGGGGCDCAEICSIGCNCAGRNGGEFAYNKTGTLLRGKPLVYECGPYC
RCPPSCPNRVSQKGLQHRLEVFRSRETGWGVRSLDLIKAGTFICEFSGIVLTHQQSEVMA
ANGDCLVRPNRFPPRWLDWGDISDVYPDYVAPDHPVIPELNFAIDVSRARNVACYFSHSC
SPNVFIQFVLFDHYNVSYPHLMIFAMENIPPLRELSIDYGMVDEWTGQLTM
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcgagggtttggggaattttggagcggaggaggaggcgagggatggtggacag
gaaggtttggttacggaaatggatgtggaggaatcctcgccgtcttcgtcgccgatgtcg
tctccggccgggtcgtcagattccatagacctcaacttcctgccgtttctcaagagggag
cccaaatcggagccgtcgtcaccagagctcgggcccctgccgctgcctgtctccctcacc
cagacgccgccgcagcagcatgcagcggcggcggctccagcaactgaggcctcggtgcct
ccgcctccggcgactcctgacctctcgtccgcgtcgatgatgaccccgctgcagtcgctg
ccgcctaacccagacgaggactcgctccttcgggagtactaccgccttgcgagactatat
ctctcgtctgcggggtccggggcgatcgtcccgacaccggcaccggaggcggccgcaccg
gcggtggtacagtccggggccgggtccgtcgtgaaaaagcgccggccgcggtcatcggag
ctcgtgcgggtctcctcgctcggtgtgcaggatcagatctacttccgcgacctcgtgcgc
cgggcgcgcatcactttcgagtgcctccgcgggctgctactcagggacgacgagcgtgct
gagtccctcggcctcgctggtgccgccgggtttggcgttgccagggaccggcgccgcgcc
cgcgcagacatgcgtgccgcagcgctcatggcagaccacgacctctggctcaatcgcgac
cgccgcatcgtggggccgatgcctgggatctcggttggtgacgctttcttcttccgcatg
gagctctgcgtgcttggcctccatggccaggtacaggcaggaattgattatgtcagtgca
gggaggtcggcctctggggagcctatagccacatctataattgtatctggtgggtatgag
gatgatgacgatcatggcgacgtacttgtgtacactgggcatggcggccgggatcccaac
ctccacaagcattgcgtcgatcagaagctggagggtggcaatcttgccctcgagcgcagc
atggcttatggtattgagattcgtgtaatccgtgccgtcaaatcaagacgaagccctatt
ggtaaggtatacttctatgatggcctctacaaagttgttgactactggctcgaccgtggg
aaatctgggtttggtgtttataagtataaaatgctgcgcattgagggccaagaacccatg
ggtactgtgaattatcgagcagctgaacaacttaaggtggatgtgtttgctgtaaggcca
acaggttatttcagctttgatatctccatgggccgagagaccttgccagttgcactctat
aatgatgttgacgatgatcaggacccactcttatttgagtatctaacacggccaattttt
cctacctctgctgtccaggggaaatttgctgagggtggtggtggtggtggttgtgattgt
gctgagatttgctcaattggatgtaactgtgcaggaaggaatggtggcgagtttgcatat
aataagactggaaccctgctacgaggcaagccactagtatatgagtgtgggccatattgc
aggtgcccacctagttgtcctaacagggttagtcagaaggggcttcaacataggcttgag
gtattccggtcaagggagactgggtggggagttcgttctttggatctcattaaggctggc
acattcatttgtgagttcagtgggattgtccttactcaccagcagtcagaggtcatggca
gcgaatggtgattgcttggtgcgtccaaataggttccctccaaggtggttggattggggt
gatatatctgatgtgtaccctgattatgtggcgccagaccatcctgttattcctgagtta
aactttgcaattgacgtgtcaagggcaaggaatgtggcatgctatttcagccacagttgc
agtccaaacgtgtttatccagtttgtgctgtttgatcattacaatgtgtcttacccccac
ctaatgatctttgccatggaaaacattccaccattgagggaactaagcatcgactatggg
atggttgatgaatggactggacaattaaccatgtag

DBGET integrated database retrieval system