KEGG   Zea mays (maize): 103650768Help
Entry
103650768         CDS       T01088                                 

Definition
(RefSeq) hexokinase-3
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
zma  Zea mays (maize)
Pathway
zma00010  Glycolysis / Gluconeogenesis
zma00051  Fructose and mannose metabolism
zma00052  Galactose metabolism
zma00500  Starch and sucrose metabolism
zma00520  Amino sugar and nucleotide sugar metabolism
zma01100  Metabolic pathways
zma01110  Biosynthesis of secondary metabolites
zma01200  Carbon metabolism
Module
zma_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
zma_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103650768
   00051 Fructose and mannose metabolism
    103650768
   00052 Galactose metabolism
    103650768
   00500 Starch and sucrose metabolism
    103650768
   00520 Amino sugar and nucleotide sugar metabolism
    103650768
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    103650768
Enzymes [BR:zma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     103650768
Membrane trafficking [BR:zma04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    103650768
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 103650768
NCBI-ProteinID: XP_008674565
UniProt: A0A1D6N1P8
LinkDB All DBs
Position
3
AA seq 497 aa AA seqDB search
MGRVGLGVAAGCAAATCAIAAALVARRAAARSRWRRAVALLREFEDGCATPPPRLRQVVD
AMVVEMHAGLASDGGSKLKMLLTFVDALPAGNEEGTYYSIDLGGTNFRVLKVEVGDGSVV
TRRKVELPIPEELIKGTIEELFNFVAVTLKEFVEAEDGKDEQRALGFTFSFPVRQTSVSS
GSLIRWTKGFLIEDVVGKDVAQCLNEALARSGLNVRVTALVNDTVGTLALGHYHDEDTVA
AVIIGAGTNACYIERTDAIIKCQGLLTNSGGMVVNMEWGNFWSSHLPRTPYDISLDDETQ
NRNDQGFEKMISGIYLGEIARLVLHRMALESDVFGDAADNLSTPFTLSTPLLAAIRKDDS
PDLSEVRRILQDHLKIPDTPLKTRRLVVKVCDIVTRRAARLAAAGIVGILKKLGRDGSGI
ASSGRTRGQLRRTVVAIEGGLYEGYPEFREYLDEALVEILGEEVARTVTLEVTVDGSGAG
AALLAAVHSSNRQQGSI
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggggcgggtcgggctcggcgtggcggcgggctgcgcggccgccacgtgcgcgatcgcc
gccgcgctggtggcgcgccgggcggcggcgcggtcgcggtggcgccgcgccgtcgcgctg
ctcagggagttcgaggacggctgcgccacgccgccgccgcgcctgcgccaggtcgtcgac
gccatggtcgtcgagatgcacgccggcctcgcgtccgacggcggcagcaagctcaagatg
ctgctcaccttcgtcgacgcgctccccgccggaaatgaagaaggcacatattattccata
gatctcggaggaacaaactttagagtgctgaaagttgaagttggtgatgggtctgtggtc
actcgccgtaaggtcgagcttcccatccctgaggaattgattaagggtacaattgaggag
ttattcaactttgttgccgtgaccctaaaggagttcgtagaagcagaagatggtaaagac
gaacaaagggcacttggtttcacattttctttcccagtcagacaaacatcagtatcttca
gggtccttaattaggtggaccaaagggtttttgattgaagatgtggttgggaaagatgtg
gctcaatgcttaaatgaagctcttgctaggagtggactaaatgtgcgagttactgcactg
gtgaatgacactgtggggacgttagctctaggtcattatcacgatgaggatacagtggct
gctgtgataatcggtgctggcaccaatgcttgctatatcgaacgcactgatgcaattatt
aaatgtcagggtcttcttacaaactctggtggcatggttgtaaacatggaatggggcaat
ttctggtcatcacatttgccaagaactccttatgacatctcccttgatgatgagacgcaa
aatcgcaatgatcaggggtttgaaaaaatgatatctgggatttatcttggggaaattgca
aggctggtgctgcatcgaatggctctagaatcagatgtctttggtgatgccgctgataat
ctatccacccccttcacattgagcacaccacttctggctgcaattcgcaaggacgattca
ccagatctgagcgaagtcagaaggatattgcaagaccatctgaagataccggacactcct
ctgaaaactcggaggctagtcgtcaaagtctgcgacatcgtcacccggagagctgcccgc
ctagccgccgctggcattgttgggatactgaaaaagctgggtcgggatgggagcggcatt
gcctcaagcgggagaacgcgagggcagctgaggcggacggtggtggcgatcgagggtggc
ctatatgagggctacccggagttcagggagtacctagatgaagccctggtggagatcttg
ggggaggaggtggcgcggacggtgacactggaggtgacagtggatgggtctggggccggc
gctgccctcctcgccgccgtacattcgtcgaatagacagcaaggttccatatag

DBGET integrated database retrieval system