KEGG   Zea mays (maize): 103651223Help
Entry
103651223         CDS       T01088                                 

Definition
(RefSeq) hexokinase-6
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
zma  Zea mays (maize)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103651223
   00051 Fructose and mannose metabolism
    103651223
   00052 Galactose metabolism
    103651223
   00500 Starch and sucrose metabolism
    103651223
   00520 Amino sugar and nucleotide sugar metabolism
    103651223
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    103651223
Enzymes [BR:zma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     103651223
Membrane trafficking [BR:zma04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    103651223
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3
AA seq 506 aa AA seqDB search
MAKGGAVVGTAVVVCAAAAAAVGVAVVLSRRRSRRREAEDERKRKAAAVIEEVEQRLSTP
TALLRGIADAMVEEMERGLRAEPHAPLKMLISYVDNLPTGDEHGLFYALDLGGTNFRVIR
VQLGGRDRRVVKQQYEEVSIPPHLMVGTSTELFDFIAAELEKFVRTEGEDFHLPDSKQRE
LGFTFSFPVHQTSISSGTLIKWTKGFCINGTVGEDVVAELSRAMERQGLDMKVAALVNDT
VGTLAGGRYADNDVVAAVILGTGTNAAYVEHANVIPKWTGLLPRSGNMVINMEWGNFRSD
KLPRSEYDKSLDFESLNPGEQIYEKMISGMYLGEIVRRILLKLAHDASLFGDVVPPKLEQ
LFILRTPDMSAMHHDTSHDLKHLGAKLKDILGVPDTSLEARYITLHVCDLVAERGARLAA
AGIYGILKKLGKDKLLGDFSQQRTVVAIDGGLYEHYKKFSACLEATLTDLLGEEVASSVV
VKLANDGSGIGAALLAASHSQYAEAA
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagggcggtgcggtcgtggggacggctgtggtggtgtgcgccgcggctgccgcg
gcggtgggggtagcggtggtgctgtcgcgcaggaggagtcggcggcgggaggcggaggac
gagaggaagaggaaggcggccgcggtaatcgaggaggtggagcagcggctctccacgccc
accgcgctgctccggggcatcgcggacgccatggtcgaggagatggagcgcggccttcgc
gctgagccccacgcgccgctcaagatgctcatcagctacgtcgacaacctcccaaccggg
gatgaacatggtctgttttatgcactggaccttggcgggaccaactttcgtgtcatccgg
gtccaacttggcggaagggacagacgtgtcgtgaagcaacagtatgaagaggtctccatt
ccgcctcatcttatggttggaacttctacggaactatttgatttcattgctgctgagttg
gaaaaatttgtgcggactgaaggagaagatttccacctaccagatagcaagcagagggaa
ctgggtttcaccttttctttcccagtgcaccaaacatctatatcatcggggactctaatt
aagtggaccaaaggattttgcatcaatggcacggttggagaagatgttgtggctgaattg
agtagggccatggaaaggcagggtcttgatatgaaagttgcagctctggttaatgatact
gtaggcacattggctggtgggagatatgctgataatgatgttgttgctgctgtaatattg
ggcactggcacaaatgcagcttatgtggaacatgcaaatgtgattcctaaatggaccggg
ctgctacctagatcagggaacatggtaatcaacatggagtggggaaacttcagatcagat
aaacttccaaggtcggagtatgataaatccttagacttcgaaagtttgaaccctggtgag
cagatatatgaaaagatgatttctggaatgtatcttggagaaattgtccggaggatcctg
ctgaaactggctcatgatgcttcattgtttggggatgttgttcctccgaaactggaacag
ctatttatactgaggacgccagatatgtcagccatgcaccatgacacctcacatgatctc
aaacacctgggagctaagctgaaggacattcttggggttcctgatacttctctggaagca
agatacatcactcttcatgtgtgcgaccttgtcgcagagagaggtgcacgcctggctgct
gctggtatatatggtattctgaagaagctgggtaaagacaaattgctaggtgactttagc
caacaaaggactgtagttgctattgacggtggcctatacgagcactacaagaagttcagt
gcctgcctagaggcgacgctcacagacctgctcggcgaggaggttgcctcatcggttgtt
gtcaagttggccaacgacggctcaggaattggagctgcacttcttgctgcctcgcactcc
cagtatgctgaagctgcatag

DBGET integrated database retrieval system