KEGG   Zymomonas mobilis subsp. mobilis CP4 = NRRL B-14023: A265_00756Help
Entry
A265_00756        CDS       T03385                                 

Gene name
tufA
Definition
(GenBank) Elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
zmc  Zymomonas mobilis subsp. mobilis CP4 = NRRL B-14023
Brite
Translation factors [BR:zmc03012]
 Eukaryotic Type
  Elongation factors
   A265_00756 (tufA)
 Prokaryotic Type
   A265_00756 (tufA)
Mitochondrial biogenesis [BR:zmc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    A265_00756 (tufA)
Exosome [BR:zmc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   A265_00756 (tufA)
  Exosomal proteins of breast cancer cells
   A265_00756 (tufA)
  Exosomal proteins of colorectal cancer cells
   A265_00756 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(852535..853728)
Genome map
AA seq 397 aa AA seqDB search
MAKAKFERNKPHCNIGTIGHVDHGKTTLTAAITKVLAEAGGGNTFVDYANIDKAPEERER
GITISTSHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREH
ILLARQVGVPALVVFMNKVDQVDDPELLELVEMEIRELLSSYDFPGDDIPIVKGSALAAL
EDKNPEIGKEAILSLMAAVDEYIPQPERPLDKSFLMPIEDVFSISGRGTVVTGRVETGIV
KVGEEVEIVGLRDTKKTTVTGVEMFRKLLDQGQAGDNIGALLRGTARTEVERGQVLAKPG
SITPHTEFKAEVYVLSKDEGGRHTPFFANYRPQFYFRTTDVTGEITLPEDVEMVMPGDNI
AFGVKLIAPIAMDPGLRFAIREGGRTVGAGVVSSIIK
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaagctaagtttgagcggaataagccgcattgtaatatcggtaccattggtcac
gtcgatcatggtaaaactaccctgactgcagctattaccaaagttttggctgaagctggt
ggcggcaacacctttgttgactatgccaacatcgataaagctccggaagaacgtgaacgc
ggtatcacgatttcaacgtctcacgttgaatacgaaaccgaaacccggcattatgcccac
gtcgactgcccgggtcatgccgattatgtgaagaacatgatcaccggtgctgctcagatg
gatggcgcaatcttggttgtatccgctgctgacggtcctatgccccagactcgtgagcac
atcctgctcgctcgtcaggtcggtgttcctgcccttgtcgtcttcatgaacaaggtcgat
caggtcgatgatccagaacttctggaactcgtcgaaatggaaatccgcgaacttctttcc
agctatgacttcccgggcgacgatattcctatcgttaagggttctgctctggctgctctg
gaagacaaaaatccggaaatcggcaaagaagccatcctttctttgatggcagctgttgat
gaatacattccgcagccggaacgtcctttggacaaaagcttcctgatgccgatcgaagat
gttttctccatctctggtcgtggtacggttgttaccggtcgtgttgaaaccggtatcgtt
aaggtcggtgaagaagtcgaaatcgtcggtcttcgtgacaccaaaaagaccaccgttacg
ggcgttgaaatgttccgcaaattgctggatcagggtcaggccggtgataacatcggtgct
ctgcttcgtggtacggcacgtacggaagttgaacgcggtcaggttttggctaaaccgggt
tccatcacgccgcataccgaattcaaggcagaagtttatgttctgtcgaaagatgaaggt
ggtcgtcacaccccgttcttcgcgaactatcgtccgcagttctatttccgcaccaccgac
gttacgggcgaaatcactttgcctgaggatgtcgaaatggttatgccaggcgacaacatt
gcgtttggtgtgaaattgattgctccgatcgctatggatccgggtcttcgcttcgctatt
cgcgaaggtggccgtaccgttggcgctggtgttgtcagctccatcattaaataa

DBGET integrated database retrieval system