KEGG   Zymomonas mobilis subsp. mobilis ATCC 10988: Zmob_1042Help
Entry
Zmob_1042         CDS       T01875                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
zmm  Zymomonas mobilis subsp. mobilis ATCC 10988
Brite
Translation factors [BR:zmm03012]
 Eukaryotic Type
  Elongation factors
   Zmob_1042
 Prokaryotic Type
   Zmob_1042
Mitochondrial biogenesis [BR:zmm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Zmob_1042
Exosome [BR:zmm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Zmob_1042
  Exosomal proteins of breast cancer cells
   Zmob_1042
  Exosomal proteins of colorectal cancer cells
   Zmob_1042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1221001..1222194
Genome map
AA seq 397 aa AA seqDB search
MAKAKFERNKPHCNIGTIGHVDHGKTTLTAAITKVLAEAGGGNTFVDYANIDKAPEERER
GITISTSHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREH
ILLARQVGVPALVVFMNKVDQVDDPELLELVEMEIRELLSSYDFPGDDIPIVKGSALAAL
EDKNPEIGKEAILSLMAAVDEYIPQPERPLDKSFLMPIEDVFSISGRGTVVTGRVETGIV
KVGEEVEIVGLRDTKKTTVTGVEMFRKLLDQGQAGDNIGALLRGTARTEVERGQVLAKPG
SITPHTEFKAEVYVLSKDEGGRHTPFFANYRPQFYFRTTDVTGEITLPEDVEMVMPGDNI
AFGVKLIAPIAMDPGLRFAIREGGRTVGAGVVSSIIK
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaagctaagtttgagcggaataagccgcattgtaatatcggtaccattggtcac
gtcgatcatggtaaaactaccctgactgcagctattaccaaagttttggctgaagctggt
ggcggcaacacctttgttgactatgccaacatcgataaagctccggaagaacgtgaacgc
ggtatcacgatttcaacgtctcacgttgaatacgaaaccgaaacccggcattatgcccac
gtcgattgcccgggtcatgccgattatgtgaagaacatgatcaccggtgctgcccagatg
gatggcgcaatcttggttgtgtccgctgctgacggtcctatgccccagactcgtgagcac
atcctgctcgctcgtcaggtcggtgttcctgcccttgtcgtcttcatgaacaaggtcgat
caggtcgatgatccagaacttctggaactcgtcgaaatggaaatccgcgaacttctttcc
agctatgacttcccgggcgacgatattcctatcgttaagggttctgctctggctgctctg
gaagacaaaaatccggaaatcggcaaagaagccatcctttctttgatggcagctgttgat
gaatacattccgcagccggaacgtcctttggacaaaagcttcctgatgccgatcgaagat
gttttctccatctctggtcgtggtacggttgttaccggtcgtgttgaaaccggtatcgtc
aaggtcggtgaagaagtcgaaatcgtcggtcttcgtgacaccaaaaagaccaccgttacg
ggcgttgaaatgttccgcaaattgctggatcagggtcaggccggtgataacatcggtgct
ctgcttcgtggtacggcacgtacggaagttgaacgcggtcaggttttggctaaaccgggt
tccatcacgccgcataccgaattcaaggcagaagtttatgttctgtcgaaagatgaaggt
ggtcgtcacaccccgttcttcgcgaactatcgtccgcagttctatttccgcaccaccgac
gttacgggcgaaatcactttgcctgaagatgtcgaaatggttatgccaggcgacaacatt
gcgtttggtgtgaaattgattgctccgatcgctatggatccgggtcttcgcttcgctatt
cgcgaaggtggccgtaccgttggcgctggtgttgtcagctccatcattaaataa

DBGET integrated database retrieval system