KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_0429Help
Entry
Zymop_0429        CDS       T01556                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:zmp00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Zymop_0429
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Zymop_0429
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Zymop_0429
Enzymes [BR:zmp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Zymop_0429
Peptidoglycan biosynthesis and degradation proteins [BR:zmp01011]
 Precursor biosynthesis
  Amino acid ligase
   Zymop_0429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(498378..499352)
Genome map
AA seq 324 aa AA seqDB search
MIMKKHVAVLMGGWSSEREISLLSGQNVAQALKEAGYHVTSLDMDRDVAFRLKEINPDVV
FNALHGTPGEDGSIQGMMDLMGICYTHSGMATSAIAIDKVLTKKILTPENIPMPEGVIVS
SDSLYQRDPLPRPYVLKPVNEGSSVGVAIIDKNFNDGQPIREDQIGPWQKFEHLLAESFI
KGKELTVAVMGDKALGVTELRPSHGFYDYEAKYTDGLTTHICPADIPLDIAEKAMTLACK
AHQILGCKGPSRSDFRWDDEAGLEGLFLLEVNTQPGMTPLSLVPEQAKQLGISYQTLCCM
IIEEALILSSDNCFNEAEMAGQSG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgattatgaaaaaacatgttgctgttttgatggggggatggtcttctgaaagagaaata
tctcttctttctggtcagaatgtagcgcaagctcttaaagaagcgggttatcatgttacc
tcgcttgatatggatcgcgatgttgctttccgattaaaagaaattaatcctgatgttgta
tttaatgccttgcatggcacaccgggtgaagatggcagcattcaaggcatgatggatttg
atggggatctgttatacccattccggtatggcgacctcggctattgctattgataaagtc
cttactaaaaaaatattaacccctgaaaatatcccaatgcctgagggggtaatcgtctca
agcgatagcctttatcaaagagacccgttgccccgtccttatgtattaaaaccggtcaat
gaaggctcatctgttggtgtcgctattattgataaaaattttaatgacggtcagcctatt
cgggaagatcaaatcgggccatggcaaaaatttgaacatcttttagccgaatcttttatc
aagggaaaagaattaacggtcgctgtcatgggcgataaagctttaggggttactgaatta
cgacctagtcatggtttttatgactatgaagcgaaatatacggatggcctgacaacccat
atatgccctgctgatattccgcttgatatagcagaaaaagcgatgacacttgcttgtaaa
gcccatcaaattttgggttgcaaggggccttctcgttctgattttcgttgggacgatgag
gccggcttagaaggcttgtttttattggaagttaatacacaacccggtatgacaccttta
agtctggtgcctgagcaggcaaaacagcttggaattagctatcagacactttgctgcatg
attattgaagaagcgcttatactttcttccgataattgcttcaatgaagcggaaatggca
ggccaaagtggctaa

DBGET integrated database retrieval system