KEGG   Zymomonas mobilis subsp. pomaceae ATCC 29192: Zymop_0701Help
Entry
Zymop_0701        CDS       T01556                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
zmp  Zymomonas mobilis subsp. pomaceae ATCC 29192
Brite
Translation factors [BR:zmp03012]
 Eukaryotic Type
  Elongation factors
   Zymop_0701
 Prokaryotic Type
   Zymop_0701
Mitochondrial biogenesis [BR:zmp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Zymop_0701
Exosome [BR:zmp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Zymop_0701
  Exosomal proteins of breast cancer cells
   Zymop_0701
  Exosomal proteins of colorectal cancer cells
   Zymop_0701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(799220..800413)
Genome map
AA seq 397 aa AA seqDB search
MAKAKFERNKPHCNIGTIGHVDHGKTTLTAAITKVLAEANGDNVFVDYANIDKAPEERER
GITISTSHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREH
ILLARQVGVPALVVFMNKVDQVDDPELLELVELEIRELLSSYDFPGDDIPIVKGSALAAL
EGKNPEIGKEAILSLMAAVDEYIPQPERPLDKNFLMPIEDVFSISGRGTVVTGRVETGIV
KVGEEVEIVGLRDTKKTTVTGVEMFRKLLDQGQAGDNIGALLRGTARTEVERGQVLAKPG
SITPHTEFKAEVYVLSKDEGGRHTPFFANYRPQFYFRTTDVTGEITLPEDVEMVMPGDNI
ALGVKLIAPIAMDPGLRFAIREGGRTVGAGVVSTINK
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaagctaagtttgagcggaataagccgcattgcaatatcggtaccatcggtcac
gtcgatcatggtaaaactaccctgacggcagctattactaaagttctggctgaagccaat
ggtgacaatgtttttgttgactatgccaacattgataaagcaccggaagaacgcgaacgt
ggtattaccatttcgacttcccacgttgaatatgaaactgcgaatcgccattatgcgcat
gtcgattgcccaggccatgctgactatgtgaaaaacatgatcactggtgccgcccaaatg
gatggtgctattctcgttgtgtccgctgctgatggccctatgccacagacccgcgaacat
atccttcttgctcgtcaggttggtgtgccagcgctcgttgtattcatgaacaaagttgat
caggtcgatgatcctgaacttctggaactcgtcgaattagaaattcgcgaacttctttcc
agctatgacttcccaggcgatgatattccgatcgttaaagggtctgctctcgccgctttg
gaaggtaagaacccagaaatcggtaaagaagctattctttctctgatggctgctgttgat
gaatacattccacagccggaacgtccactcgacaaaaacttcctgatgccaatcgaagat
gtgttctcgatttctggtcgcggtaccgttgtaacgggtcgtgttgaaaccggtatcgtc
aaggtcggtgaagaagttgaaatcgttggtctgcgtgataccaaaaagaccacggtaacc
ggcgttgaaatgttccgcaagctgcttgatcaaggtcaggctggcgataatattggtgcg
ctgcttcgtggtacggctcgtaccgaagttgagcgtggtcaggttcttgctaaaccaggt
tccatcacgccgcatactgaattcaaagctgaagtttacgtgctgtcgaaagacgaaggt
ggccgtcatacgccgttcttcgcaaactatcgtccgcagttctacttccgtaccacggat
gttaccggtgaaattacgttaccggaagacgtcgaaatggttatgccaggcgacaatatc
gccctcggtgtgaagctgattgccccgatcgctatggatccgggtcttcgtttcgctatc
cgtgaaggtggccgtaccgttggtgccggtgttgtgagcacgatcaacaagtaa

DBGET integrated database retrieval system