KEGG   Zootermopsis nevadensis: 110837647Help
Entry
110837647         CDS       T05136                                 

Definition
(RefSeq) thymidine kinase, cytosolic-like
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
zne  Zootermopsis nevadensis
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zne00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    110837647
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    110837647
Enzymes [BR:zne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     110837647
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 224 aa AA seqDB search
MEHLPFNTGQIQIIFGPMFSGKTTELIRRLKRYQIAKYKCLIIKYACDDRYSASDIVSHD
RQSLAAVSARKITDFGFKVLEYDVIGIDEGQFFPDIVERCEEFANLGKIVIIAALDGTFQ
RVGFGNILNLIPLAENVVKLNAVCMICFREASFTKRIGSETKLEVIGGADKYMAVCRDCY
REPVVSRSLQKQTDNEVTKNMDVINCKVSPKKSLLQEGAVTVCI
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggaacaccttcctttcaatactggccagattcagattatttttggtccaatgttttct
gggaaaactacagaattaatacgacgattgaaacgttaccagatagcaaagtacaagtgc
cttattataaaatatgcatgtgatgatcgctacagtgcaagtgacattgttagtcatgat
cgtcagtcattggcagctgtttctgcaagaaagattacagatttcggattcaaagttctt
gagtatgatgttattggtattgatgaaggccaattttttcctgatatagtggagcgttgc
gaagaatttgcaaaccttggtaagatagtgattatagcagcacttgatggtacatttcag
cgagttgggtttgggaacattttgaaccttattcctttggctgaaaatgtggtgaaactt
aatgctgtctgcatgatatgcttcagagaagcttcttttacgaagaggattggtagtgag
acaaagttggaggtgattggtggtgcagataagtacatggctgtctgtcgagattgctac
cgtgaacctgttgtgtcaagatctctacagaagcaaacagataatgaggtcacaaaaaat
atggacgttattaattgcaaggtgtcacctaagaaatcattgcttcaagaaggagcagta
actgtttgcatctga

DBGET integrated database retrieval system