KEGG   Zootermopsis nevadensis: 110840495Help
Entry
110840495         CDS       T05136                                 

Definition
(RefSeq) glutathione S-transferase 1-1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
zne  Zootermopsis nevadensis
Pathway
zne00480  Glutathione metabolism
zne00980  Metabolism of xenobiotics by cytochrome P450
zne00982  Drug metabolism - cytochrome P450
zne00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:zne00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    110840495
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    110840495
   00982 Drug metabolism - cytochrome P450
    110840495
   00983 Drug metabolism - other enzymes
    110840495
Enzymes [BR:zne01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     110840495
Transporters [BR:zne02000]
 Other Transporters
  Pores ion channels [TC:1]
   110840495
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_C GST_N_2 GST_C_3 GST_C_2 MetRS-N
Motif
Other DBs
NCBI-GeneID: 110840495
NCBI-ProteinID: XP_021941264
LinkDB All DBs
Position
Unknown
AA seq 216 aa AA seqDB search
MTIDFYYVPGSAPCRSVLLAAKVVGVDLNLKLTNLMAGEHLTPAFLKMNPQHTVPTLNDG
GFYLWESRAILSYLADKYGKDDSLYPKDPKKRALVDQRLYFDIGTLYQRFGDYYYPIMFA
KATGDPEKFKKIEESYNFLDKFLDGQDFVAGNNLTIADIAIISSVSTADILGFDVSKYHN
VAKWYEKCKKIIPGYDELNHSGCLKFKEMYDNLTKK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgatttctactacgtgcctggcagtgcaccttgtcgctctgtcctgctggca
gccaaagttgttggtgtggatctgaacctcaaattgactaatctcatggcaggcgaacat
cttacacctgcgtttctgaagatgaatcctcagcacacagttcccactctcaatgacggt
ggattttatctctgggaaagtcgtgccattcttagctatctagctgacaaatatggaaag
gatgattcgctctatccgaaggacccaaagaagcgtgcccttgttgatcaaaggctgtac
tttgatatcgggactctgtatcagagatttggtgattattattacccaatcatgtttgct
aaagccactggtgacccagagaagtttaagaaaattgaagaatcttataatttcctggac
aaatttctagatgggcaggattttgtagcaggaaacaatctcacaattgcagacatagca
ataatttcttcagtttccactgcggatattcttggttttgacgtgagtaagtaccataat
gttgctaagtggtatgagaagtgcaagaagattattcctggttatgatgaactcaatcac
tccggatgtttgaagttcaaagaaatgtatgacaacctcaccaagaagtga

DBGET integrated database retrieval system