KEGG   Zunongwangia profunda: ZPR_4553Help
Entry
ZPR_4553          CDS       T01216                                 

Definition
(GenBank) alpha-ketoglutarate decarboxylase
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
zpr  Zunongwangia profunda
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:zpr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ZPR_4553
  Amino acid metabolism
   00310 Lysine degradation
    ZPR_4553
   00380 Tryptophan metabolism
    ZPR_4553
Enzymes [BR:zpr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     ZPR_4553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4904208..4906979)
Genome map
AA seq 923 aa AA seqDB search
MDRFSFLNAAHTAYFAELYDQYLQYPDSVEPSWRAFFQGFDFGMEQNDVSSETLGSAPVS
IEEGEMPEHVYKEFQVIRLIDGYRTRGHLFTKTNPVRERRHYEPRLDIENFGLSEEDLDT
TFSAGDILGIGPKKLKEIIQHLENIYCDAIGVEYMFIRKPEEIDWIQKKLNVNENHPDFD
SERKKQILRKLNEAVSFEGFLHRKYVGQKRFSLEGGETLIPALDALIEGAAEKGVKDFVM
GMAHRGRLNTLTNIFGKSAKDIFSEFDGKDYEQDIFDGDVKYHLGWTSCRQTQSGKEINI
NIAPNPSHLETVGPVVEGIARAKRDRRYSGDPSKVLPILVHGDAAVAAQGVVYEVVQMAK
LDGYENAGTIHIVVNNQIGFTTNYLDARSSTYCTDVAKVTLSPVLHVNADDAEAVVHAVL
FALDFRMEFKRDVFIDLLGYRKYGHNEGDEPRFTQPKLYKAIAKHKNARDIYAEKLIKAG
VIDESYIEKLEEDYKQKLEEDLEDSRKEDTTRITPFMEDEWGGYENVQEDRMMEDVDTTV
KMEELDRVAKAISKLPEGKKFLRKIEKIINLREQMYFEDNRLDWSMGEHLAYGTLMAEGY
NIRISGQDSERGTFSHRHAVLKVEDSEEEIILHNNIEGREGDFFIYNSPLSEYGVVGFDY
GYAMASPNTLTIWEAQFGDFVNGAQIMIDQYISAAEDKWKLQNGLVMFLPHGYEGQGAEH
SSARMERFLQLCAKDNMFVADVTTPANMFHLLRRQMKFGFRKPLIIFTPKSLLRHSKVIS
TKEDFAEGSFQMLIDDPAANVEKVKTLVFCTGKFYYDLLEYKEENEREDVALVRVEQLFP
LPVEKMKAIMSKYKNADDVVWAQEEPKNMGAYGHMLMHIDEAKQFRCCSRKFYGSPAAGS
SVRFKKRHQRVIDSVFDKSLTEE
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atggacagattttcatttctaaatgccgcgcatactgcatattttgctgaattatacgat
caatatttacaatatcctgatagtgtagagcccagttggagagctttttttcagggcttt
gattttggtatggagcaaaatgatgtttcatcagaaactttaggatcagctcctgtatcg
attgaggaaggcgaaatgcctgagcatgtttacaaggagtttcaggttataaggcttatt
gatggttatcgtactcgcggacatttatttaccaaaacaaacccggtaagggagagaaga
cattacgaaccaagacttgacattgagaattttggtttaagtgaggaggatttagatact
acttttagtgcgggtgatattttaggtattggacccaaaaaactaaaagaaattattcag
cacctggagaatatatattgcgatgctattggagtagagtatatgtttattcgaaagcct
gaagaaattgattggattcagaaaaaactgaatgtaaatgaaaaccatccggattttgat
tcggaaaggaaaaaacaaatccttagaaagcttaatgaagcggtctcttttgaaggtttt
ttacatagaaaatatgttggtcaaaagcgattctctttagaaggaggcgagactttaatt
ccggcattagatgccttgattgaaggtgctgctgaaaaaggcgttaaggattttgtaatg
ggtatggctcaccgtggtcgtttgaatacacttacaaatatctttggtaaatctgcgaaa
gatatctttagcgaatttgatggtaaggattacgaacaggatatttttgatggtgatgta
aaataccatttgggttggacttcttgtcgccaaacccaaagcggaaaggaaatcaatatc
aatattgcgccaaacccttctcatttagaaacggtaggtccggtagtagaaggtattgcc
agagctaaaagagatcgaagatatagcggcgatccctctaaagttttgccaatcctggtg
catggtgatgctgctgttgctgcgcagggtgttgtatacgaagttgtacaaatggctaag
ttagatggttacgagaatgccggtactattcatatcgttgtaaataatcaaataggtttt
acaacaaattatttagatgcaagatcttctacttattgtaccgatgttgcaaaagtaact
ctatctcctgtacttcatgtaaatgcagatgatgcagaagctgttgtgcatgcggtgctt
tttgcgttagattttagaatggaatttaagcgggatgtatttatagatctattaggatat
agaaaatacgggcacaatgaaggtgatgagccaagatttacacagcctaaactttataaa
gcaatagcaaagcataaaaatgcaagagatatttatgcggaaaaattaataaaagcaggg
gtgatagatgaatcctacatcgaaaaacttgaagaggattataagcaaaagctcgaagaa
gatctagaagattccagaaaggaagacacaaccagaatcacaccttttatggaagatgaa
tggggtggctacgaaaatgtacaggaagatcgcatgatggaagatgttgatacgactgta
aaaatggaagagctagatcgcgttgccaaagccatttctaaattgcctgaaggtaaaaag
ttcttacgtaaaatagagaaaatcatcaatttacgtgaacaaatgtattttgaagataat
aggctggattggtctatgggagaacatctggcctatggaactctaatggctgaaggttat
aatataagaattagtggtcaggatagcgagcgtggtacgttttcacaccgtcatgcggta
ctaaaagtagaagatagcgaagaagaaattatccttcataacaatattgaaggaagggaa
ggcgatttctttatatataactctccattatctgaatacggagtggtaggctttgattat
ggttatgctatggcaagtccaaataccctaaccatttgggaggcgcaatttggggatttt
gtgaatggcgcacagattatgatcgatcaatacatctctgccgcagaggataagtggaaa
ttgcaaaacggactggtaatgttcctgccgcatggctatgaaggccagggagcagaacat
tcatcagcaagaatggagcgttttcttcaactttgtgcaaaagataatatgtttgttgcc
gatgtgacgacgccagctaacatgtttcatttgctaagaagacaaatgaagtttggtttc
aggaagccactcattatctttactcctaagagtttattaagacactcaaaagtgatttca
accaaggaagattttgctgaaggttctttccagatgctaatcgatgatcctgcggctaat
gtagagaaagttaaaactttggtgttctgtaccggtaagttttattacgatcttttagag
tataaggaagaaaatgaacgtgaggatgtggcactggtaagagtggaacagttattcccg
cttccggtagagaaaatgaaggcgattatgagtaaatataaaaatgccgatgatgttgtt
tgggctcaggaagaacctaaaaatatgggagcgtatgggcatatgctaatgcatattgat
gaagcaaagcagtttagatgttgtagtcgtaaattctatggatctcctgctgctggtagt
tcagtacgtttcaagaaaagacatcagcgagtgatcgacagtgtttttgataaatcatta
actgaagaataa

DBGET integrated database retrieval system