KEGG   Zygosaccharomyces rouxii: ZYRO0C13156gHelp
Entry
ZYRO0C13156g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
zro  Zygosaccharomyces rouxii
Pathway
zro04011  MAPK signaling pathway - yeast
zro04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:zro00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    ZYRO0C13156g
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    ZYRO0C13156g
Enzymes [BR:zro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     ZYRO0C13156g
Protein kinases [BR:zro01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   ZYRO0C13156g
Chromosome and associated proteins [BR:zro03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     ZYRO0C13156g
Exosome [BR:zro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ZYRO0C13156g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like APH Kdo
Motif
Other DBs
NCBI-GeneID: 8203436
NCBI-ProteinID: XP_002496212
UniProt: C5DU18
LinkDB All DBs
Position
C:complement(1041022..1042068)
Genome map
AA seq 348 aa AA seqDB search
MGKRIVFNISSEFQLKALLGEGAYGVVCSAIHKPTGEIVAIKKIEPFDKPLFALRTLREI
KILKHFRHENIISIFDVQRPDCFENFNEVYLIQELMQTDLHRVITTQPLTDDHIQYFVYQ
TLRAVKVLHGSNVIHRDLKPSNLLINSNCDLKICDFGLARIADDPRAEAPMNSGMTEYVA
TRWYRAPEVMLTAAKYTKAMDIWSCGCILAELFLKRPLFPGKDYRHQLMLIFGVVGTPLG
EDLVNIESRRAREYIATLPTFTPVPLRRILPGVNPLGVDLLQRMLAFDPRKRISAAEALR
HPYLKTYHDPLDEPEGEPIPSTFFEFDNHKEALTTKDLKMLLWKEIFV
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggggaagagaattgttttcaacatctccagtgaattccaattgaaggcattgttaggt
gagggcgcttatggtgtcgtatgttcagcaatacataaacccaccggagaaatcgttgcc
atcaaaaagatcgaaccctttgataaacctcttttcgctctaagaacacttagagagata
aagattttgaaacatttccgtcatgaaaacattatatcaatatttgacgtacagagacct
gattgttttgaaaacttcaatgaagtatatctcattcaagaattgatgcaaaccgatctt
catcgtgttatcactacgcaaccattgacagatgatcacattcaatattttgtctatcag
accttaagagcagttaaagtactgcatggttccaacgttatccatagagatttgaaacct
tcgaacttgttaatcaattccaattgtgatctcaagatatgtgattttggacttgccagg
atcgctgatgatccacgtgcagaggcacccatgaatagtggtatgactgaatacgttgct
actagatggtacagagcacctgaggttatgttaaccgccgctaagtatacgaaagctatg
gacatttggtcttgcggatgtatcttggcagagttgtttttgaagagaccacttttcccc
ggtaaagattaccgtcatcagctgatgttaatatttggagttgtcggtacaccattaggt
gaagatctagtaaacattgaatcgagaagagcaagggagtatattgctacattacctact
tttactcctgtaccactgcgcagaattctgccgggtgttaatccactgggagtagatctt
ctgcaaaggatgcttgcgttcgatcctcgcaagagaatcagcgcggctgaagcattaaga
catccatacttaaaaacttaccatgacccattagatgaacctgagggtgaaccaatcccg
tcaactttcttcgagttcgataaccataaggaggcgttgacgacaaaggacctcaagatg
ctactatggaaagaaatattcgtttga

DBGET integrated database retrieval system