KEGG   Zygosaccharomyces rouxii: ZYRO0D14916gHelp
Entry
ZYRO0D14916g      CDS       T01118                                 

Definition
(RefSeq) hypothetical protein
  KO
K02358  elongation factor Tu
Organism
zro  Zygosaccharomyces rouxii
Brite
Translation factors [BR:zro03012]
 Eukaryotic Type
  Elongation factors
   ZYRO0D14916g
 Prokaryotic Type
   ZYRO0D14916g
Mitochondrial biogenesis [BR:zro03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    ZYRO0D14916g
Exosome [BR:zro04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ZYRO0D14916g
  Exosomal proteins of breast cancer cells
   ZYRO0D14916g
  Exosomal proteins of colorectal cancer cells
   ZYRO0D14916g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-GeneID: 8204344
NCBI-ProteinID: XP_002497078
UniProt: C5DWH6
LinkDB All DBs
Position
D:1252760..1254058
Genome map
AA seq 432 aa AA seqDB search
MSLFPRLAPRLVSRNFLKPQCVARSFTTTLRASAAAFDRSKPHLNVGTIGHVDHGKTTLT
AALTKTLAKNGGADFLEYASIDKAPEERARGITISTAHVEYQTDKRHYSHVDCPGHADYI
KNMITGAAQMDGAIIVVAATDGQMPQTREHLLLARQVGVQHIVVFVNKVDMMDDPEMLEL
VEMEMRELLSEYGFDGDNVPIIMGSALCALEGKRPEIGEDAIMKLLDAVDEYIPTPSRDM
EKPFLLPVEDIFSISGRGTVVTGRVERGNLKKGEEIEIVGHNTAPLRTTVTGIEMFRKEL
DQAMAGDNAGILLRGIKRDQLKRGMVLAKPGSVKSHTRFLASLYILSKDEGGRHSGFGEN
YRPQVYIRTADVTVILKFPSEVEDHSMQVLPGDNVEMECELIHPTPLEVGQRFNIREGGK
TVGTGLITRIMD
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtcattattccccagattggctcctagattggtttcgaggaatttcctcaagcctcaa
tgcgtagctagatcttttaccactactctacgtgcatctgcagcagcatttgatcgttct
aaaccccatttgaatgttggtaccattggtcatgttgaccatggtaagacaactttgact
gcagcattgaccaagactttggctaaaaatggtggtgctgatttcttggaatatgcatct
attgataaagcccctgaagaacgtgcgcgtggtatcaccatctctactgctcatgttgaa
taccaaactgataaaagacattactcccacgtcgactgtcctggtcacgccgattacatc
aaaaatatgattactggtgctgcacaaatggatggtgctatcattgtggttgctgccact
gatggtcaaatgcctcaaactagagaacacttgttgttggcaagacaagtcggtgttcaa
cacattgttgtcttcgttaacaaagttgatatgatggatgatcctgaaatgttggaattg
gtcgaaatggaaatgagagaattactttctgaatacggttttgatggtgacaatgttcca
atcattatgggttctgctctttgtgcattggaaggtaagcgtccagaaattggtgaagac
gccattatgaaattattggatgccgttgatgaatacattccaactccatcaagagatatg
gaaaaacctttcttgttgccagttgaagatattttctccatctctggtagaggtactgtc
gttaccggtcgtgttgaaagaggtaacttgaagaaaggtgaagaaattgaaatcgtcggt
cacaacactgctccattgagaactactgtcactggtattgaaatgttcagaaaggaattg
gaccaagctatggctggtgacaatgcaggtattcttttgagaggtatcaagagagatcaa
ttaaagagaggtatggtcttggctaagccaggttctgttaaatctcacactagatttttg
gcttctctttacatcttgtctaaggatgaaggtggtagacattctggtttcggtgaaaat
tacagacctcaagtgtacatcagaactgctgacgttacagttatcttaaagttcccaagt
gaagtggaagatcattctatgcaagtcctgccaggtgataacgttgaaatggaatgtgag
ttgatccatccaactccattggaagtgggtcaacgtttcaacattagagagggtggtaag
accgtcggtaccggtttgatcactcgtatcatggattga

DBGET integrated database retrieval system