KEGG   Zymoseptoria tritici: MYCGRDRAFT_100586Help
Entry
MYCGRDRAFT_100586 CDS       T02285                                 

Gene name
HKX1
Definition
(RefSeq) hypothetical protein
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
ztr  Zymoseptoria tritici
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ztr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYCGRDRAFT_100586 (HKX1)
   00051 Fructose and mannose metabolism
    MYCGRDRAFT_100586 (HKX1)
   00052 Galactose metabolism
    MYCGRDRAFT_100586 (HKX1)
   00500 Starch and sucrose metabolism
    MYCGRDRAFT_100586 (HKX1)
   00520 Amino sugar and nucleotide sugar metabolism
    MYCGRDRAFT_100586 (HKX1)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MYCGRDRAFT_100586 (HKX1)
Enzymes [BR:ztr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     MYCGRDRAFT_100586 (HKX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
6
AA seq 496 aa AA seqDB search
MVGLGPRRKPSRKGSMADMPQDLLSEIKRLEELFIVDTPKLKSITEHFISELAKGLTKEG
GSIPMNPTWVMGYPTGHETGTFLALDMGGTNLRVCEINLPEEKGEFDIIQSKYRMPEELK
TGNADELWGYIADCLQQFIEYHHEGEKLDKLPLGFTFSYPATQDFIDHGVLQRWTKGFDI
DGVEGKDVVPPFEAALQERGVPIKLTALINDTTGTLIASSYTDPEMKIGCIFGTGCNAAY
MEHAGEIPKLEDWKMDPKQEIAINCEWGAFDNEHKVLPRTPYDIIIDKDSPRPGQQAFEK
MIAGLYLGELFRLVLVDLHEKNVVFQGQDIAALRKPYSLDASYLSDIENDPFENLQETAD
NFKSVLNITTSKPELELIRRLAELIGTRSARLSACGVAAICKKKGYKTAHVGADGSVFNK
YPHFKQRGAAALKEILDWETGRDGKPLGKGNDPVEIMPAEDGSGVGAALIAALTLKRAKE
GKLEGIRDAESMLKGM
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggtcggcctcggaccacggcgcaagcccagccgcaagggctccatggcagacatgcca
caggacttgctttcggagatcaagcgcttggaagagttgttcatcgtggacaccccaaag
ctcaagagcatcaccgagcacttcatctcggagctggccaagggcctcacaaaggagggc
ggcagcatcccaatgaacccgacctgggtcatgggctacccgactggacacgagactggc
actttcctcgcactcgacatgggcggtaccaacttgcgcgtctgtgagatcaacctgcca
gaggagaagggcgagttcgacatcatccagtccaagtaccgcatgccagaggagctcaag
accggcaacgccgatgagctttggggatacatcgccgactgtctgcaacaattcatcgag
taccaccacgagggtgagaagttggacaagctcccactcggcttcaccttctcctaccca
gcgacacaggacttcatcgatcacggtgtgctgcagcgctggaccaagggtttcgacatt
gatggtgtcgagggcaaggatgtcgttccgccattcgaggctgcgctacaggaacgtggc
gtcccaatcaaattgactgcactcatcaacgacaccaccggtaccctcattgctagcagc
tacacggatccggagatgaagattggatgcattttcggtactggctgcaacgctgcgtac
atggagcacgctggtgagattccaaagctcgaggactggaaaatggacccgaagcaggag
atcgccattaactgcgaatggggtgcctttgacaacgagcacaaggttctcccgcgcaca
ccatacgacatcatcatcgacaaggactcgcctcgtcctggtcagcaagctttcgagaag
atgatcgctggtctctatcttggtgagctattccgtttggtgcttgtcgatctccacgag
aagaacgtcgttttccagggccaggacatcgccgcgcttcgcaagccctactcgctcgat
gcctcatacctctccgacatcgagaacgatcctttcgagaacttgcaggagaccgccgac
aacttcaaatccgttctcaacatcaccaccagcaagcctgagctcgagttgataagacga
ctggctgagctcatcggcacgcggtcggcgaggttgagcgcatgtggtgtggcggcgatc
tgcaagaagaagggatacaagactgctcacgtcggtgctgatggttcggtgtttaacaag
taccctcacttcaagcaacgcggagcagctgctctgaaggagattctcgactgggagact
ggccgtgacggcaagccgctcggcaagggcaacgacccggtggagatcatgccggctgag
gatggttctggtgttggcgcagccctcatcgccgctcttacgctcaagcgcgccaaggag
ggcaagctcgagggtatccgtgatgccgagtccatgctcaagggtatgtga

DBGET integrated database retrieval system