KEGG   Aquifex aeolicus: aq_497Help
Entry
aq_497            CDS       T00013                                 

Gene name
gsdA
Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  
glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
aae  Aquifex aeolicus
Pathway
Pentose phosphate pathway
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aae00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    aq_497 (gsdA)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    aq_497 (gsdA)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    aq_497 (gsdA)
Enzymes [BR:aae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     aq_497 (gsdA)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     aq_497 (gsdA)
Exosome [BR:aae04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   aq_497 (gsdA)
  Exosomal proteins of colorectal cancer cells
   aq_497 (gsdA)
  Exosomal proteins of bladder cancer cells
   aq_497 (gsdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(334072..335367)
Genome map
AA seq 431 aa AA seqDB search
MSSGDTELRKRIEFIIFGGTGDLSRNKLIPAILKLKDKIDLKKIYILGRNRKKFEEIKEK
FKDFSELFVFVEFLAEREESYKNISSILGKESLKVFYLAVPPDLFKEILENVGKYLNFPE
KRIVIEKPFGLSLKHAKDLNKIISVYFKEEEIFRIDHYLGKPQVQNILAFKFSNYVFSEV
LNKCLVEKVEVIALEEVGVEGRKAYYEKVGVIRDMLQNHMLLLSSLIVMRLPPRAEDFHF
ELKNALKRAEFESESLILGKYKSYQGKAPTFALVKLHFDDERFTGVPFVLATGKKLKKKL
TRVCIHFKNFPKEIERLLGCVPERNLLVFELYPEQEVSFRVNVISPLGFLRCTESINWRV
SLKDVLGEIPEAYESLLLDVIRGDKTLFLDAEETEILWEKTEPLLKKEKEVLTYDDRVLI
PEFAEDFISCL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgggagacacagagttaagaaaaaggattgaatttataatcttcggcggaacc
ggggatctgagcagaaataaattaattcccgcaatcctgaaactgaaagacaaaatagat
ttaaagaagatttacattttaggcaggaataggaaaaagtttgaagaaataaaagaaaag
tttaaggatttttcagagttattcgtgttcgtagaattcctcgcggagagggaagagagt
tataaaaatatatcaagtattttaggaaaagaatctttaaaagttttttaccttgcggta
cctcccgacctattcaaggaaattctagaaaacgtaggaaaatacctgaactttccagaa
aaacgtattgttattgaaaaacctttcggcctcagcttaaagcacgcaaaggacttaaac
aaaataatttccgtttatttcaaagaagaagaaatcttcagaatagatcactacctcgga
aagccgcaggttcaaaatatactcgcctttaagttctcaaattacgtgttttccgaagtc
ttaaacaagtgtcttgtagagaaggtggaggtaattgcccttgaagaggtgggagtagag
ggcagaaaagcttattacgagaaagtgggagtcataagggacatgctacagaatcacatg
ttgctcctctcctctttaatcgttatgagactccctccaagggcggaggacttccacttt
gagctgaagaacgccttaaagcgtgccgagtttgagtccgagagcttgatactcggaaag
tacaaaagttatcaaggaaaagctcccacttttgcccttgtaaaactccactttgacgac
gagcgtttcaccggagtgcctttcgtactcgccacgggaaaaaagttaaagaaaaaattg
acgagggtgtgcatccactttaagaacttcccgaaggagattgaacggcttctcggctgc
gttcctgagagaaatttactcgtttttgaactctatccagagcaggaagtttcctttagg
gtaaacgttatatctccacttggctttttgaggtgtacggaaagtattaactggagagtt
tccctcaaagacgttctgggagaaattcccgaagcttacgagtccctccttctggacgtc
ataaggggagacaagacgctctttctggacgcagaggagacggagatactctgggaaaaa
acagaacctctattgaaaaaagaaaaggaagttttgacttacgatgacagagtccttatt
ccagaatttgcagaggatttcatttcctgcctttga

DBGET integrated database retrieval system