KEGG   Addendum: AAA25265Help
Entry
AAA25265          CDS       T10000                                 

Gene name
zwf
Definition
(KEGG) glucose-6-phosphate dehydrogenase [NAD(P)+] (EC:1.1.1.363)
  KO
K00036  
glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Taxonomy
TAX:1245
  Lineage
Bacteria; Firmicutes; Bacilli; Lactobacillales; Leuconostocaceae; Leuconostoc
Organism
ag  Addendum (Leuconostoc mesenteroides)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
GB: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
AA seq 486 aa AA seqDB search
MVSEIKTLVTFFGGTGDLAKRKLYPSVFNLYKKGYLQKHFAIVGTARQALNDDEFKQLVR
DSIKDFTDDQAQAEAFIEHFSYRAHDVTDAASYAVLKEAIEEAADKFDIDGNRIFYMSVA
PRFFGTIAKYLKSEGLLADTGYNRLMIEKPFGTSYDTAAELQNDLENAFDDNQLFRIDHY
LGKEMVQNIAALRFGNPIFDAAWNKDYIKNVQVTLSEVLGVEERAGYYDTAGALLDMIQN
HTMQIVGWLAMEKPESFTDKDIRAAKNAAFNALKIYDEAEVNKYFVRAQYGAGDSADFKP
YLEELDVPADSKNNTFIAGELQFDLPRWEGVPFYVRSGKRLAAKQTRVDIVFKAGTFNFG
SEQEAQEAVLSIIIDPKGAIELKLNAKSVEDAFNTRTIDLGWTVSDEDKKNTPEPYERMI
HDTMNGDGSNFADWNGVSIAWKFVDAISAVYTADKAPLETYKSGSMGPEASDKLLAANGD
AWVFKG
Reference
PMID:4396688
  Authors
Olive C, Geroch ME, Levy HR
  Title
Glucose 6-phosphate dehydrogenase from Leuconostoc mesenteroides. Kinetic studies.
  Journal
J Biol Chem 246:2047-57 (1971)
Reference
PMID:2071589
  Authors
Lee WT, Flynn TG, Lyons C, Levy HR
  Title
Cloning of the gene and amino acid sequence for glucose 6-phosphate dehydrogenase from Leuconostoc mesenteroides.
  Journal
J Biol Chem 266:13028-34 (1991)

DBGET integrated database retrieval system