KEGG   Addendum: BAD95974Help
Entry
BAD95974          CDS       T10000                                 

Gene name
araA
Definition
(KEGG) L-arabinose 1-dehydrogenase [NAD(P)+] (EC:1.1.1.376)
  KO
K13873  
L-arabinose 1-dehydrogenase [EC:1.1.1.376]
Taxonomy
TAX:192
  Lineage
Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales; Rhodospirillaceae; Azospirillum
Organism
ag  Addendum (Azospirillum brasilense)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
GB: 
UniProt: 
LinkDB All DBs
AA seq 309 aa AA seqDB search
MSDQVSLGVVGIGKIARDQHLPAIDAEPGFKLTACASRHAEVTGVRNYRDLRALLAAERE
LDAVSLCAPPQVRYAQARAALEAGKHVMLEKPPGATLGEVAVLEALARERGLTLFATWHS
RCASAVEPAREWLATRAIRAVQVRWKEDVRRWHPGQQWIWEPGGLGVFDPGINALSIVTR
ILPRELVLREATLIVPSDVQTPIAAELDCADTDGVPVRAEFDWRHGPVEQWEIAVDTADG
VLAISRGGAQLSIAGEPVELGPEREYPALYAHFHALIARGESDVDVRPLRLVADAFLFGR
RVQTDAFGR
Reference
  Authors
Watanabe S, Kodaki T, Makino K
  Title
Cloning, expression, and characterization of bacterial L-arabinose 1-dehydrogenase involved in an alternative pathway of L-arabinose metabolism.
  Journal
J Biol Chem 281:2612-23 (2006)

DBGET integrated database retrieval system