KEGG   Homo sapiens (human): 10950Help
Entry
10950             CDS       T01001                                 

Gene name
BTG3, ANA, TOB5, TOB55, TOFA
Definition
BTG family, member 3
Orthology
K14443  
protein Tob/BTG
Organism
hsa  Homo sapiens (human)
Pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    10950 (BTG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
21q21.1
AA seq 296 aa AA seqDB search
MKNEIAAVVFFFTRLVRKHDKLKKEAVERFAEKLTLILQEKYKNHWYPEKPSKGQAYRCI
RVNKFQRVDPDVLKACENSCILYSDLGLPKELTLWVDPCEVCCRRDGVSPCWPDCSQTPD
LVIRPPWPPKALDYRREPLRPASSFLIMYGEKNNAFIVASFENKDENKDEISRKVTRALD
KVTSDYHSGSSSSDEETSKEMEVKPSSVTAAASPVYQISELIFPPLPMWHPLPRKKPGMY
RGNGHQNHYPPPVPFGYPNQGRKNKPYRPIPVTWVPPPGMHCDRNHWINPHMLAPH
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatgaaattgctgccgttgtcttctttttcacaaggctagttcgaaaacatgat
aagttgaaaaaagaggcagttgagaggtttgctgagaaattgaccctaatacttcaagaa
aaatataaaaatcactggtatccagaaaaaccatcgaaaggacaggcctacagatgtatt
cgtgtcaataaatttcagagagttgatcctgatgtcctgaaagcctgtgaaaacagctgc
atcttgtatagtgacctgggcttgccaaaggagctcactctctgggtggacccatgtgag
gtgtgctgtcgtagagatggggtttcaccatgttggccagactgctctcaaactcctgac
ctcgtgatccgcccgccttggcctcccaaagcgctggattacaggcgtgagccactgcgc
ccggcctcctcctttttgattatgtatggagagaaaaacaatgcattcattgttgccagc
tttgaaaataaagatgagaacaaggatgagatctccaggaaagttaccagggcccttgat
aaggttacctctgattatcattcaggatcctcttcttcagatgaagaaacaagtaaggaa
atggaagtgaaacccagttcggtgactgcagccgcaagtcctgtgtaccagatttcagaa
cttatatttccacctcttccaatgtggcaccctttgcccagaaaaaagccaggaatgtat
cgagggaatggccatcagaatcactatcctcctcctgttccatttggttatccaaatcag
ggaagaaaaaataaaccatatcgcccaattccagtgacatgggtacctcctcctggaatg
cattgtgaccggaatcactggattaatcctcacatgttagcacctcactaa

DBGET integrated database retrieval system