KEGG   Homo sapiens (human): 162417Help
Entry
162417            CDS       T01001                                 

Gene name
NAGS, AGAS, ARGA
Definition
N-acetylglutamate synthase (EC:2.3.1.1)
Orthology
K11067  
N-acetylglutamate synthase [EC:2.3.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
Arginine and proline metabolism
Metabolic pathways
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Disease
H01032  
N-acetylglutamate synthase (NAGS) deficiency
H01398  
Primary hyperammonemic disorders
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    162417 (NAGS)
   01230 Biosynthesis of amino acids
    162417 (NAGS)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    162417 (NAGS)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     162417 (NAGS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
17q21.31
AA seq 534 aa AA seqDB search
MATALMAVVLRAAAVAPRLRGRGGTGGARRLSCGARRRAARGTSPGRRLSTAWSQPQPPP
EEYAGADDVSQSPVAEEPSWVPSPRPPVPHESPEPPSGRSLVQRDIQAFLNQCGASPGEA
RHWLTQFQTCHHSADKPFAVIEVDEEVLKCQQGVSSLAFALAFLQRMDMKPLVVLGLPAP
TAPSGCLSFWEAKAQLAKSCKVLVDALRHNAAAAVPFFGGGSVLRAAEPAPHASYGGIVS
VETDLLQWCLESGSIPILCPIGETAARRSVLLDSLEVTASLAKALRPTKIIFLNNTGGLR
DSSHKVLSNVNLPADLDLVCNAEWVSTKERQQMRLIVDVLSRLPHHSSAVITAASTLLTE
LFSNKGSGTLFKNAERMLRVRSLDKLDQGRLVDLVNASFGKKLRDDYLASLRPRLHSIYV
SEGYNAAAILTMEPVLGGTPYLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNP
INPWYFKHSDGSFSNKQWIFFWFGLADIRDSYELVNHAKGLPDSFHKPASDPGS
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggcgctgatggctgtggttctgcgggcagctgctgtagccccgaggctgaga
ggccggggaggcactgggggcgcccgaaggctgagctgtggcgcgcggcggcgggcggcg
aggggcaccagcccggggcgccggctcagcaccgcctggtcgcagccccagcccccgccc
gaggagtacgcgggcgcggacgacgtctcccagtcgcccgtcgccgaggagccgtcgtgg
gtgccgagtcccaggcccccggtgccccacgagtccccagagcctccttcgggccgctcg
ctggtgcagcgggacatccaggccttcctgaaccagtgcggggccagccctggggaggcg
cgccactggctcacgcagttccagacctgccatcactccgcggacaagcccttcgccgtc
atcgaggtggacgaggaggtgctcaagtgccagcagggcgtatccagtctggcctttgcc
ctggccttcttgcagcgcatggacatgaagccgctggtggtcctggggctgccggcccct
acggctccctcgggctgtctttccttctgggaggccaaggcgcagctggccaagagctgc
aaggtgctggtagacgcgcttcgacacaacgccgccgctgctgtgccattttttggcggc
gggtctgtgctacgcgctgccgagccggctccccatgccagctacggcggcatcgtctcg
gtggagacagacctgctgcagtggtgcctggagtcgggcagcatccccatcctgtgcccc
atcggggagacggccgcgcgccgctccgtgcttctcgactccctggaggtgaccgcgtcg
ctggccaaggcgctgcggcccaccaaaatcatcttcctcaataacacaggcggcctgcgc
gacagcagtcataaggtcctgagtaacgtgaacctgcccgccgacctggacctggtgtgc
aacgccgagtgggtgagcacaaaagaacggcagcagatgcggctcatcgtggacgtgctc
agccgcctgccccaccactcctcggccgtcatcaccgccgctagcacgctgctcactgag
ctctttagcaacaaggggtccgggaccctgttcaagaacgccgagcgaatgctacgggtg
cgcagcctggacaagctggaccagggccgtctagtggacctggtcaacgccagcttcggc
aagaagctcagggacgactacctggcctcgctgcgcccgcggctgcactccatctacgtc
tccgaggggtacaacgccgccgccattctgaccatggagcccgtcctggggggcaccccg
tacctggacaaatttgtggtgagctccagccgccagggccaaggctccggccagatgctg
tgggagtgcctgcggcgggaccttcagacacttttctggcgctcccgggtcaccaacccc
atcaatccctggtacttcaaacacagtgatggcagcttctccaacaagcagtggatcttc
ttctggtttggcctggctgatatccgggactcctatgagttggtcaaccacgccaaggga
ctgccagactcctttcacaagccagcttctgacccaggcagctga

DBGET integrated database retrieval system