KEGG   Homo sapiens (human): 2099Help
Entry
2099              CDS       T01001                                 

Gene name
ESR1, ER, ESR, ESRA, ESTRR, Era, NR3A1
Definition
(RefSeq) estrogen receptor 1
  KO
K08550  
estrogen receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
Endocrine resistance
Estrogen signaling pathway
Prolactin signaling pathway
Thyroid hormone signaling pathway
Endocrine and other factor-regulated calcium reabsorption
Proteoglycans in cancer
Breast cancer
Drug target
Acolbifene hydrochloride: 
Afimoxifene: 
Arzoxifene hydrochloride: 
Bazedoxifene: 
Clomifene (DG00474): 
Conjugated estrogens (DG00465): 
Dienestrol: 
Diethylstilbestrol (DG00466): 
Droloxifene (DG01265): 
Enclomiphene: 
Epitiostanol: 
Equilin: 
Estradiol (DG00462): 
Estriol (DG00463): 
Estrogens, esterified: 
Estrone (DG00464): 
Ethinylestradiol (DG00461): 
Fispemifene: 
Fulvestrant: 
Idoxifene: 
Lasofoxifene: 
Levormeloxifene fumarate: 
Mepitiostane: 
Mestranol: 
Miproxifene phosphate: 
Nafoxidine hydrochloride: 
Nitromifene citrate: 
Ormeloxifen: 
Ospemifene: 
Polyestradiol phosphate: 
Promestriene: 
Raloxifene (DG00476): 
Tamoxifen (DG00734): 
Tibolone: 
Toremifene (DG00735): 
Trioxifene mesylate: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    2099 (ESR1)
   04917 Prolactin signaling pathway
    2099 (ESR1)
   04919 Thyroid hormone signaling pathway
    2099 (ESR1)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    2099 (ESR1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    2099 (ESR1)
   05224 Breast cancer
    2099 (ESR1)
  Drug resistance
   01522 Endocrine resistance
    2099 (ESR1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 estrogen-like
    2099 (ESR1)
Nuclear receptors [BR:hsa03310]
 3. Estrogen like
  3A. Estrogen receptor
   2099 (ESR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 
5DXE 5KCT 3UUD 2IOG 1XPC 2QXS 1XP6 2QZO 5FQV 4ZNV 5KD9 2B1Z 4MGA 2B1V 1XP9 1XP1 5KCD 2YJA 2POG 5KCE 4TV1 4MG8 4MGB 2QSE 2QA8 5DXG 4ZNS 5FQP 5FQR 5ACC 2QAB 5DZI 5AAU 4ZNT 4TUZ 4PXM 4MGD 3L03 2AYR 1YIM 1SJ0 3ERT 5KCW 5DWE 4ZN7 4ZNH 4PPS 4IWF 5FQS 2P15 5AAV 4IVY 2Q70 1L2I 5E1C 4IW6 5FQT 5E0W 5DWJ 4MG9 2R6W 2R6Y 2QR9 2OUZ 2BJ4 1X7R 5E0X 5KCU 5DY8 3OS8 3ERD 4IW8 4MG5 3UUA 3Q95 1XQC 4IVW 5KCF 5DRJ 5DXB 5DX3 5DUE 5E15 5DL4 4MG6 3UUC 3Q97 2FAI 2B23 5DZH 4IV2 5DZ3 5DKG 4MG7 4MGC 2QGT 5AK2 5DZ1 5DXP 5DU5 4PP6 3UU7 1YIN 5E14 4ZN9 5DXK 5E19 5DZ0 5DUH 5DRM 5DIG 5DI7 5DID 5DIE 4Q13 4IWC 5DUG 1ZKY 5DLR 5HYR 5DYB 5DXR 5DVS 5DK9 1UOM 4IU7 5DWG 5DTV 4IV4 4IUI 4DMA 3OS9 3OSA 2QXM 2G5O 4ZNW 3HM1 5DXM 5DP0 5KCC 2QGW 5EI1 5DXQ 5DMC 5DMF 5DKB 4ZNU 3DT3 2QE4 2IOK 1GWR 1HCQ 5DWI 1GWQ 5DYD 4XI3 5EHJ 5DVV 2JFA 5DKE 5DKS 4AA6 2YAT 2QA6 1ERR 2G44 5EIT 4PPP 2QH6 2Q6J 1R5K 1PCG 1X7E 1A52 5EGV 2I0J 1G50 2OCF 3HLV 4Q50 1ERE 2JF9 1QKT 1QKU 1HCP
Thumbnails

Jmol
Position
6q25.1
AA seq 595 aa AA seqDB search
MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAY
EFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPF
LQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAK
ETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQAC
RLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKR
SKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINW
AKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG
MVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLD
KITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLL
LEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgaccctccacaccaaagcatctgggatggccctactgcatcagatccaaggg
aacgagctggagcccctgaaccgtccgcagctcaagatccccctggagcggcccctgggc
gaggtgtacctggacagcagcaagcccgccgtgtacaactaccccgagggcgccgcctac
gagttcaacgccgcggccgccgccaacgcgcaggtctacggtcagaccggcctcccctac
ggccccgggtctgaggctgcggcgttcggctccaacggcctggggggtttccccccactc
aacagcgtgtctccgagcccgctgatgctactgcacccgccgccgcagctgtcgcctttc
ctgcagccccacggccagcaggtgccctactacctggagaacgagcccagcggctacacg
gtgcgcgaggccggcccgccggcattctacaggccaaattcagataatcgacgccagggt
ggcagagaaagattggccagtaccaatgacaagggaagtatggctatggaatctgccaag
gagactcgctactgtgcagtgtgcaatgactatgcttcaggctaccattatggagtctgg
tcctgtgagggctgcaaggccttcttcaagagaagtattcaaggacataacgactatatg
tgtccagccaccaaccagtgcaccattgataaaaacaggaggaagagctgccaggcctgc
cggctccgcaaatgctacgaagtgggaatgatgaaaggtgggatacgaaaagaccgaaga
ggagggagaatgttgaaacacaagcgccagagagatgatggggagggcaggggtgaagtg
gggtctgctggagacatgagagctgccaacctttggccaagcccgctcatgatcaaacgc
tctaagaagaacagcctggccttgtccctgacggccgaccagatggtcagtgccttgttg
gatgctgagccccccatactctattccgagtatgatcctaccagacccttcagtgaagct
tcgatgatgggcttactgaccaacctggcagacagggagctggttcacatgatcaactgg
gcgaagagggtgccaggctttgtggatttgaccctccatgatcaggtccaccttctagaa
tgtgcctggctagagatcctgatgattggtctcgtctggcgctccatggagcacccaggg
aagctactgtttgctcctaacttgctcttggacaggaaccagggaaaatgtgtagagggc
atggtggagatcttcgacatgctgctggctacatcatctcggttccgcatgatgaatctg
cagggagaggagtttgtgtgcctcaaatctattattttgcttaattctggagtgtacaca
tttctgtccagcaccctgaagtctctggaagagaaggaccatatccaccgagtcctggac
aagatcacagacactttgatccacctgatggccaaggcaggcctgaccctgcagcagcag
caccagcggctggcccagctcctcctcatcctctcccacatcaggcacatgagtaacaaa
ggcatggagcatctgtacagcatgaagtgcaagaacgtggtgcccctctatgacctgctg
ctggagatgctggacgcccaccgcctacatgcgcccactagccgtggaggggcatccgtg
gaggagacggaccaaagccacttggccactgcgggctctacttcatcgcattccttgcaa
aagtattacatcacgggggaggcagagggtttccctgccacggtctga

KEGG   Homo sapiens (human): 2100Help
Entry
2100              CDS       T01001                                 

Gene name
ESR2, ER-BETA, ESR-BETA, ESRB, ESTRB, Erb, NR3A2
Definition
(RefSeq) estrogen receptor 2
  KO
K08551  
estrogen receptor beta
Organism
hsa  Homo sapiens (human)
Pathway
Endocrine resistance
Estrogen signaling pathway
Prolactin signaling pathway
Breast cancer
Drug target
Acolbifene hydrochloride: 
Afimoxifene: 
Arzoxifene hydrochloride: 
Bazedoxifene: 
Clomifene (DG00474): 
Conjugated estrogens (DG00465): 
Dienestrol: 
Diethylstilbestrol (DG00466): 
Droloxifene (DG01265): 
Enclomiphene: 
Epitiostanol: 
Equilin: 
Erteberel: 
Estradiol (DG00462): 
Estriol (DG00463): 
Estrogens, esterified: 
Estrone (DG00464): 
Ethinylestradiol (DG00461): 
Fispemifene: 
Fulvestrant: 
Idoxifene: 
Lasofoxifene: 
Levormeloxifene fumarate: 
Mepitiostane: 
Mestranol: 
Miproxifene phosphate: 
Nafoxidine hydrochloride: 
Nitromifene citrate: 
Ormeloxifen: 
Ospemifene: 
Polyestradiol phosphate: 
Prinaberel: 
Promestriene: 
Raloxifene (DG00476): 
Tamoxifen (DG00734): 
Tibolone: 
Toremifene (DG00735): 
Trioxifene mesylate: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    2100 (ESR2)
   04917 Prolactin signaling pathway
    2100 (ESR2)
 Human Diseases
  Cancers
   05224 Breast cancer
    2100 (ESR2)
  Drug resistance
   01522 Endocrine resistance
    2100 (ESR2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 estrogen-like
    2100 (ESR2)
Nuclear receptors [BR:hsa03310]
 3. Estrogen like
  3A. Estrogen receptor
   2100 (ESR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
14q23.2
AA seq 530 aa AA seqDB search
MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPS
NVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVN
RETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGH
NDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLH
CAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTK
LADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDL
VLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLVTATQDA
DSSRKLAHLLNAVTDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLNMK
CKNVVPVYDLLLEMLNAHVLRGCKSSITGSECSPAEDSKSKEGSQNPQSQ
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggatataaaaaactcaccatctagccttaattctccttcctcctacaactgcagtcaa
tccatcttacccctggagcacggctccatatacataccttcctcctatgtagacagccac
catgaatatccagccatgacattctatagccctgctgtgatgaattacagcattcccagc
aatgtcactaacttggaaggtgggcctggtcggcagaccacaagcccaaatgtgttgtgg
ccaacacctgggcacctttctcctttagtggtccatcgccagttatcacatctgtatgcg
gaacctcaaaagagtccctggtgtgaagcaagatcgctagaacacaccttacctgtaaac
agagagacactgaaaaggaaggttagtgggaaccgttgcgccagccctgttactggtcca
ggttcaaagagggatgctcacttctgcgctgtctgcagcgattacgcatcgggatatcac
tatggagtctggtcgtgtgaaggatgtaaggccttttttaaaagaagcattcaaggacat
aatgattatatttgtccagctacaaatcagtgtacaatcgataaaaaccggcgcaagagc
tgccaggcctgccgacttcggaagtgttacgaagtgggaatggtgaagtgtggctcccgg
agagagagatgtgggtaccgccttgtgcggagacagagaagtgccgacgagcagctgcac
tgtgccggcaaggccaagagaagtggcggccacgcgccccgagtgcgggagctgctgctg
gacgccctgagccccgagcagctagtgctcaccctcctggaggctgagccgccccatgtg
ctgatcagccgccccagtgcgcccttcaccgaggcctccatgatgatgtccctgaccaag
ttggccgacaaggagttggtacacatgatcagctgggccaagaagattcccggctttgtg
gagctcagcctgttcgaccaagtgcggctcttggagagctgttggatggaggtgttaatg
atggggctgatgtggcgctcaattgaccaccccggcaagctcatctttgctccagatctt
gttctggacagggatgaggggaaatgcgtagaaggaattctggaaatctttgacatgctc
ctggcaactacttcaaggtttcgagagttaaaactccaacacaaagaatatctctgtgtc
aaggccatgatcctgctcaattccagtatgtaccctctggtcacagcgacccaggatgct
gacagcagccggaagctggctcacttgctgaacgccgtgaccgatgctttggtttgggtg
attgccaagagcggcatctcctcccagcagcaatccatgcgcctggctaacctcctgatg
ctcctgtcccacgtcaggcatgcgagtaacaagggcatggaacatctgctcaacatgaag
tgcaaaaatgtggtcccagtgtatgacctgctgctggagatgctgaatgcccacgtgctt
cgcgggtgcaagtcctccatcacggggtccgagtgcagcccggcagaggacagtaaaagc
aaagagggctcccagaacccacagtctcagtga

DBGET integrated database retrieval system