KEGG   Homo sapiens (human): 27436Help
Entry
27436             CDS       T01001                                 

Gene name
EML4, C2orf2, ELP120, EMAP-4, EMAPL4, ROPP120
Definition
echinoderm microtubule associated protein like 4
Orthology
K15420  
echinoderm microtubule-associated protein-like 4
Organism
hsa  Homo sapiens (human)
Pathway
Non-small cell lung cancer
Disease
H00014  
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05223 Non-small cell lung cancer
    27436 (EML4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
2p21
AA seq 923 aa AA seqDB search
MDGFAGSLDDSISAASTSDVQDRLSALESRVQQQEDEITVLKAALADVLRRLAISEDHVA
SVKKSVSSKGQPSPRAVIPMSCITNGSGANRKPSHTSAVSIAGKETLSSAAKSIKRPSPA
EKSHNSWENSDDSRNKLSKIPSTPKLIPKVTKTADKHKDVIINQEGEYIKMFMRGRPITM
FIPSDVDNYDDIRTELPPEKLKLEWAYGYRGKDCRANVYLLPTGEIVYFIASVVVLFNYE
ERTQRHYLGHTDCVKCLAIHPDKIRIATGQIAGVDKDGRPLQPHVRVWDSVTLSTLQIIG
LGTFERGVGCLDFSKADSGVHLCVIDDSNEHMLTVWDWQKKAKGAEIKTTNEVVLAVEFH
PTDANTIITCGKSHIFFWTWSGNSLTRKQGIFGKYEKPKFVQCLAFLGNGDVLTGDSGGV
MLIWSKTTVEPTPGKGPKGVYQISKQIKAHDGSVFTLCQMRNGMLLTGGGKDRKIILWDH
DLNPEREIEVPDQYGTIRAVAEGKADQFLVGTSRNFILRGTFNDGFQIEVQGHTDELWGL
ATHPFKDLLLTCAQDRQVCLWNSMEHRLEWTRLVDEPGHCADFHPSGTVVAIGTHSGRWF
VLDAETRDLVSIHTDGNEQLSVMRYSIDGTFLAVGSHDNFIYLYVVSENGRKYSRYGRCT
GHSSYITHLDWSPDNKYIMSNSGDYEILYWDIPNGCKLIRNRSDCKDIDWTTYTCVLGFQ
VFGVWPEGSDGTDINALVRSHNRKVIAVADDFCKVHLFQYPCSKAKAPSHKYSAHSSHVT
NVSFTHNDSHLISTGGKDMSIIQWKLVEKLSLPQNETVADTTLTKAPVSSTESVIQSNTP
TPPPSQPLNETAEEESRISSSPTLLENSLEQTVEPSEDHSEEESEEGSGDLGEPLYEEPC
NEISKEQAKATLLEDQQDPSPSS
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atggacggtttcgccggcagtctcgatgatagtatttctgctgcaagtacttctgatgtt
caagatcgcctgtcagctcttgagtcacgagttcagcaacaagaagatgaaatcactgtg
ctaaaggcggctttggctgatgttttgaggcgtcttgcaatctctgaagatcatgtggcc
tcagtgaaaaaatcagtctcaagtaaaggccaaccaagccctcgagcagttattcccatg
tcctgtataaccaatggaagtggtgcaaacagaaaaccaagtcataccagtgctgtctca
attgcaggaaaagaaactctttcatctgctgctaaaagcataaaacgaccatcaccagct
gaaaagtcacataattcttgggaaaattcagatgatagccgtaataaattgtcgaaaata
ccttcaacacccaaattaataccaaaagttaccaaaactgcagacaagcataaagatgtc
atcatcaaccaagaaggagaatatattaaaatgtttatgcgcggtcggccaattaccatg
ttcattccttccgatgttgacaactatgatgacatcagaacggaactgcctcctgagaag
ctcaaactggagtgggcatatggttatcgaggaaaggactgtagagctaatgtttacctt
cttccgaccggggaaatagtttatttcattgcatcagtagtagtactatttaattatgag
gagagaactcagcgacactacctgggccatacagactgtgtgaaatgccttgctatacat
cctgacaaaattaggattgcaactggacagatagctggcgtggataaagatggaaggcct
ctacaaccccacgtcagagtgtgggattctgttactctatccacactgcagattattgga
cttggcacttttgagcgtggagtaggatgcctggatttttcaaaagcagattcaggtgtt
catttatgtgttattgatgactccaatgagcatatgcttactgtatgggactggcagaag
aaagcaaaaggagcagaaataaagacaacaaatgaagttgttttggctgtggagtttcac
ccaacagatgcaaataccataattacatgcggtaaatctcatattttcttctggacctgg
agcggcaattcactaacaagaaaacagggaatttttgggaaatatgaaaagccaaaattt
gtgcagtgtttagcattcttggggaatggagatgttcttactggagactcaggtggagtc
atgcttatatggagcaaaactactgtagagcccacacctgggaaaggacctaaaggtgta
tatcaaatcagcaaacaaatcaaagctcatgatggcagtgtgttcacactttgtcagatg
agaaatgggatgttattaactggaggagggaaagacagaaaaataattctgtgggatcat
gatctgaatcctgaaagagaaatagaggttcctgatcagtatggcacaatcagagctgta
gcagaaggaaaggcagatcaatttttagtaggcacatcacgaaactttattttacgagga
acatttaatgatggcttccaaatagaagtacagggtcatacagatgagctttggggtctt
gccacacatcccttcaaagatttgctcttgacatgtgctcaggacaggcaggtgtgcctg
tggaactcaatggaacacaggctggaatggaccaggctggtagatgaaccaggacactgt
gcagattttcatccaagtggcacagtggtggccataggaacgcactcaggcaggtggttt
gttctggatgcagaaaccagagatctagtttctatccacacagacgggaatgaacagctc
tctgtgatgcgctactcaatagatggtaccttcctggctgtaggatctcatgacaacttt
atttacctctatgtagtctctgaaaatggaagaaaatatagcagatatggaaggtgcact
ggacattccagctacatcacacaccttgactggtccccagacaacaagtatataatgtct
aactcgggagactatgaaatattgtactgggacattccaaatggctgcaaactaatcagg
aatcgatcggattgtaaggacattgattggacgacatatacctgtgtgctaggatttcaa
gtatttggtgtctggccagaaggatctgatgggacagatatcaatgcactggtgcgatcc
cacaatagaaaggtgatagctgttgccgatgacttttgtaaagtccatctgtttcagtat
ccctgctccaaagcaaaggctcccagtcacaagtacagtgcccacagcagccatgtcacc
aatgtcagttttactcacaatgacagtcacctgatatcaactggtggaaaagacatgagc
atcattcagtggaaacttgtggaaaagttatctttgcctcagaatgagactgtagcggat
actactctaaccaaagcccccgtctcttccactgaaagtgtcatccaatctaatactccc
acaccgcctccttctcagcccttaaatgagacagctgaagaggaaagtagaataagcagt
tctcccacacttctggagaacagcctggaacaaactgtggagccaagtgaagaccacagc
gaggaggagagtgaagagggcagcggagaccttggtgagcctctttatgaagagccatgc
aacgagataagcaaggagcaggccaaagccacccttctggaggaccagcaagacccttcg
ccctcgtcctaa

KEGG   Homo sapiens (human): 238Help
Entry
238               CDS       T01001                                 

Gene name
ALK, CD246, NBLST3
Definition
anaplastic lymphoma receptor tyrosine kinase (EC:2.7.10.1)
Orthology
K05119  
anaplastic lymphoma kinase [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
Non-small cell lung cancer
Disease
H00014  
Non-small cell lung cancer
Drug target
Crizotinib: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05223 Non-small cell lung cancer
    238 (ALK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     238 (ALK)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  Alk family
   238 (ALK)
Enzyme-linked receptors [BR:hsa01020]
 Receptor tyrosine kinases
  RTK class X (LTK receptor family)
   238 (ALK)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class X (LTK receptor family)
   238 (ALK)
Cellular antigens [BR:hsa04090]
 Proteins
  238 (ALK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
2p23
AA seq 1620 aa AA seqDB search
MGAIGLLWLLPLLLSTAAVGSGMGTGQRAGSPAAGPPLQPREPLSYSRLQRKSLAVDFVV
PSLFRVYARDLLLPPSSSELKAGRPEARGSLALDCAPLLRLLGPAPGVSWTAGSPAPAEA
RTLSRVLKGGSVRKLRRAKQLVLELGEEAILEGCVGPPGEAAVGLLQFNLSELFSWWIRQ
GEGRLRIRLMPEKKASEVGREGRLSAAIRASQPRLLFQIFGTGHSSLESPTNMPSPSPDY
FTWNLTWIMKDSFPFLSHRSRYGLECSFDFPCELEYSPPLHDLRNQSWSWRRIPSEEASQ
MDLLDGPGAERSKEMPRGSFLLLNTSADSKHTILSPWMRSSSEHCTLAVSVHRHLQPSGR
YIAQLLPHNEAAREILLMPTPGKHGWTVLQGRIGRPDNPFRVALEYISSGNRSLSAVDFF
ALKNCSEGTSPGSKMALQSSFTCWNGTVLQLGQACDFHQDCAQGEDESQMCRKLPVGFYC
NFEDGFCGWTQGTLSPHTPQWQVRTLKDARFQDHQDHALLLSTTDVPASESATVTSATFP
APIKSSPCELRMSWLIRGVLRGNVSLVLVENKTGKEQGRMVWHVAAYEGLSLWQWMVLPL
LDVSDRFWLQMVAWWGQGSRAIVAFDNISISLDCYLTISGEDKILQNTAPKSRNLFERNP
NKELKPGENSPRQTPIFDPTVHWLFTTCGASGPHGPTQAQCNNAYQNSNLSVEVGSEGPL
KGIQIWKVPATDTYSISGYGAAGGKGGKNTMMRSHGVSVLGIFNLEKDDMLYILVGQQGE
DACPSTNQLIQKVCIGENNVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMKDGVPVPLII
AAGGGGRAYGAKTDTFHPERLENNSSVLGLNGNSGAAGGGGGWNDNTSLLWAGKSLQEGA
TGGHSCPQAMKKWGWETRGGFGGGGGGCSSGGGGGGYIGGNAASNNDPEMDGEDGVSFIS
PLGILYTPALKVMEGHGEVNIKHYLNCSHCEVDECHMDPESHKVICFCDHGTVLAEDGVS
CIVSPTPEPHLPLSLILSVVTSALVAALVLAFSGIMIVYRRKHQELQAMQMELQSPEYKL
SKLRTSTIMTDYNPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGMPN
DPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMA
GGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCP
GPGRVAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLW
EIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIIL
ERIEYCTQDPDVINTALPIEYGPLVEEEEKVPVRPKDPEGVPPLLVSQQAKREEERSPAA
PPPLPTTSSGKAAKKPTAAEISVRVPRGPAVEGGHVNMAFSQSNPPSELHKVHGSRNKPT
SLWNPTYGSWFTEKPTKKNNPIAKKEPHDRGNLGLEGSCTVPPNVATGRLPGASLLLEPS
SLTANMKEVPLFRLRHFPCGNVNYGYQQQGLPLEAATAPGAGHYEDTILKSKNSMNQPGP
NT seq 4863 nt NT seq  +upstreamnt  +downstreamnt
atgggagccatcgggctcctgtggctcctgccgctgctgctttccacggcagctgtgggc
tccgggatggggaccggccagcgcgcgggctccccagctgcggggccgccgctgcagccc
cgggagccactcagctactcgcgcctgcagaggaagagtctggcagttgacttcgtggtg
ccctcgctcttccgtgtctacgcccgggacctactgctgccaccatcctcctcggagctg
aaggctggcaggcccgaggcccgcggctcgctagctctggactgcgccccgctgctcagg
ttgctggggccggcgccgggggtctcctggaccgccggttcaccagccccggcagaggcc
cggacgctgtccagggtgctgaagggcggctccgtgcgcaagctccggcgtgccaagcag
ttggtgctggagctgggcgaggaggcgatcttggagggttgcgtcgggccccccggggag
gcggctgtggggctgctccagttcaatctcagcgagctgttcagttggtggattcgccaa
ggcgaagggcgactgaggatccgcctgatgcccgagaagaaggcgtcggaagtgggcaga
gagggaaggctgtccgcggcaattcgcgcctcccagccccgccttctcttccagatcttc
gggactggtcatagctccttggaatcaccaacaaacatgccttctccttctcctgattat
tttacatggaatctcacctggataatgaaagactccttccctttcctgtctcatcgcagc
cgatatggtctggagtgcagctttgacttcccctgtgagctggagtattcccctccactg
catgacctcaggaaccagagctggtcctggcgccgcatcccctccgaggaggcctcccag
atggacttgctggatgggcctggggcagagcgttctaaggagatgcccagaggctccttt
ctccttctcaacacctcagctgactccaagcacaccatcctgagtccgtggatgaggagc
agcagtgagcactgcacactggccgtctcggtgcacaggcacctgcagccctctggaagg
tacattgcccagctgctgccccacaacgaggctgcaagagagatcctcctgatgcccact
ccagggaagcatggttggacagtgctccagggaagaatcgggcgtccagacaacccattt
cgagtggccctggaatacatctccagtggaaaccgcagcttgtctgcagtggacttcttt
gccctgaagaactgcagtgaaggaacatccccaggctccaagatggccctgcagagctcc
ttcacttgttggaatgggacagtcctccagcttgggcaggcctgtgacttccaccaggac
tgtgcccagggagaagatgagagccagatgtgccggaaactgcctgtgggtttttactgc
aactttgaagatggcttctgtggctggacccaaggcacactgtcaccccacactcctcaa
tggcaggtcaggaccctaaaggatgcccggttccaggaccaccaagaccatgctctattg
ctcagtaccactgatgtccccgcttctgaaagtgctacagtgaccagtgctacgtttcct
gcaccgatcaagagctctccatgtgagctccgaatgtcctggctcattcgtggagtcttg
aggggaaacgtgtccttggtgctagtggagaacaaaaccgggaaggagcaaggcaggatg
gtctggcatgtcgccgcctatgaaggcttgagcctgtggcagtggatggtgttgcctctc
ctcgatgtgtctgacaggttctggctgcagatggtcgcatggtggggacaaggatccaga
gccatcgtggcttttgacaatatctccatcagcctggactgctacctcaccattagcgga
gaggacaagatcctgcagaatacagcacccaaatcaagaaacctgtttgagagaaaccca
aacaaggagctgaaacccggggaaaattcaccaagacagacccccatctttgaccctaca
gttcattggctgttcaccacatgtggggccagcgggccccatggccccacccaggcacag
tgcaacaacgcctaccagaactccaacctgagcgtggaggtggggagcgagggccccctg
aaaggcatccagatctggaaggtgccagccaccgacacctacagcatctcgggctacgga
gctgctggcgggaaaggcgggaagaacaccatgatgcggtcccacggcgtgtctgtgctg
ggcatcttcaacctggagaaggatgacatgctgtacatcctggttgggcagcagggagag
gacgcctgccccagtacaaaccagttaatccagaaagtctgcattggagagaacaatgtg
atagaagaagaaatccgtgtgaacagaagcgtgcatgagtgggcaggaggcggaggagga
gggggtggagccacctacgtatttaagatgaaggatggagtgccggtgcccctgatcatt
gcagccggaggtggtggcagggcctacggggccaagacagacacgttccacccagagaga
ctggagaataactcctcggttctagggctaaacggcaattccggagccgcaggtggtgga
ggtggctggaatgataacacttccttgctctgggccggaaaatctttgcaggagggtgcc
accggaggacattcctgcccccaggccatgaagaagtgggggtgggagacaagagggggt
ttcggagggggtggaggggggtgctcctcaggtggaggaggcggaggatatataggcggc
aatgcagcctcaaacaatgaccccgaaatggatggggaagatggggtttccttcatcagt
ccactgggcatcctgtacaccccagctttaaaagtgatggaaggccacggggaagtgaat
attaagcattatctaaactgcagtcactgtgaggtagacgaatgtcacatggaccctgaa
agccacaaggtcatctgcttctgtgaccacgggacggtgctggctgaggatggcgtctcc
tgcattgtgtcacccaccccggagccacacctgccactctcgctgatcctctctgtggtg
acctctgccctcgtggccgccctggtcctggctttctccggcatcatgattgtgtaccgc
cggaagcaccaggagctgcaagccatgcagatggagctgcagagccctgagtacaagctg
agcaagctccgcacctcgaccatcatgaccgactacaaccccaactactgctttgctggc
aagacctcctccatcagtgacctgaaggaggtgccgcggaaaaacatcaccctcattcgg
ggtctgggccatggcgcctttggggaggtgtatgaaggccaggtgtccggaatgcccaac
gacccaagccccctgcaagtggctgtgaagacgctgcctgaagtgtgctctgaacaggac
gaactggatttcctcatggaagccctgatcatcagcaaattcaaccaccagaacattgtt
cgctgcattggggtgagcctgcaatccctgccccggttcatcctgctggagctcatggcg
gggggagacctcaagtccttcctccgagagacccgccctcgcccgagccagccctcctcc
ctggccatgctggaccttctgcacgtggctcgggacattgcctgtggctgtcagtatttg
gaggaaaaccacttcatccaccgagacattgctgccagaaactgcctcttgacctgtcca
ggccctggaagagtggccaagattggagacttcgggatggcccgagacatctacagggcg
agctactatagaaagggaggctgtgccatgctgccagttaagtggatgcccccagaggcc
ttcatggaaggaatattcacttctaaaacagacacatggtcctttggagtgctgctatgg
gaaatcttttctcttggatatatgccataccccagcaaaagcaaccaggaagttctggag
tttgtcaccagtggaggccggatggacccacccaagaactgccctgggcctgtataccgg
ataatgactcagtgctggcaacatcagcctgaagacaggcccaactttgccatcattttg
gagaggattgaatactgcacccaggacccggatgtaatcaacaccgctttgccgatagaa
tatggtccacttgtggaagaggaagagaaagtgcctgtgaggcccaaggaccctgagggg
gttcctcctctcctggtctctcaacaggcaaaacgggaggaggagcgcagcccagctgcc
ccaccacctctgcctaccacctcctctggcaaggctgcaaagaaacccacagctgcagag
atctctgttcgagtccctagagggccggccgtggaagggggacacgtgaatatggcattc
tctcagtccaaccctccttcggagttgcacaaggtccacggatccagaaacaagcccacc
agcttgtggaacccaacgtacggctcctggtttacagagaaacccaccaaaaagaataat
cctatagcaaagaaggagccacacgacaggggtaacctggggctggagggaagctgtact
gtcccacctaacgttgcaactgggagacttccgggggcctcactgctcctagagccctct
tcgctgactgccaatatgaaggaggtacctctgttcaggctacgtcacttcccttgtggg
aatgtcaattacggctaccagcaacagggcttgcccttagaagccgctactgcccctgga
gctggtcattacgaggataccattctgaaaagcaagaatagcatgaaccagcctgggccc
tga

DBGET integrated database retrieval system