KEGG   Homo sapiens (human): 282617Help
Entry
282617            CDS       T01001                                 

Gene name
IFNL3, IL-28B, IL28B, IL28C
Definition
interferon, lambda 3
Orthology
K05447  
interleukin 28/29 (interferon, lambda)
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    282617 (IFNL3)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    282617 (IFNL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
19q13.13
AA seq 196 aa AA seqDB search
MTGDCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDAL
EESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLD
QPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFR
LLTRDLNCVASGDLCV
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaccggggactgcatgccagtgctggtgctgatggccgcagtgctgaccgtgactgga
gcagttcctgtcgccaggctccgcggggctctcccggatgcaaggggctgccacatagcc
cagttcaagtccctgtctccacaggagctgcaggcctttaagagggccaaagatgcctta
gaagagtcgcttctgctgaaggactgcaagtgccgctcccgcctcttccccaggacctgg
gacctgaggcagctgcaggtgagggagcgccccgtggctttggaggctgagctggccctg
acgctgaaggttctggaggccaccgctgacactgacccagccctgggggatgtcttggac
cagccccttcacaccctgcaccatatcctctcccagctccgggcctgtatccagcctcag
cccacggcagggcccaggacccggggccgcctccaccattggctgcaccggctccaggag
gccccaaaaaaggagtcccctggctgcctcgaggcctctgtcaccttcaacctcttccgc
ctcctcacgcgagacctgaattgtgttgccagcggggacctgtgtgtctga

DBGET integrated database retrieval system