KEGG   Homo sapiens (human): 3643Help
Entry
3643              CDS       T01001                                 

Gene name
INSR, CD220, HHF5
Definition
(RefSeq) insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04520  Adherens junction
hsa04910  Insulin signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04923  Regulation of lipolysis in adipocytes
hsa04930  Type II diabetes mellitus
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04960  Aldosterone-regulated sodium reabsorption
Module
hsa_M00676  PI3K-Akt signaling
Disease
H00719  Leprechaunism
H00942  Rabson-Mendenhall syndrome
H01228  Insulin-resistant diabetes mellitus with acanthosis nigricans (IRAN)
H01267  Familial hyperinsulinemic hypoglycemia (HHF)
Drug target
Insulin: D00085
Insulin (human): D03230
Insulin (pork): D04548
Insulin I 125: D04544
Insulin I 131: D04545
Insulin aspart: D04475
Insulin degludec: D09727
Insulin detemir: D04539
Insulin glargine: D03250
Insulin glulisine: D04540
Insulin human zinc: D04542
Insulin human zinc, extended: D04543
Insulin human, isophane: D04541
Insulin injection, biphasic isophane: D08080
Insulin lispro: D04477
Insulin peglispro: D10473
Insulin zinc: D04551
Insulin zinc, extended: D04549
Insulin zinc, prompt: D04550
Insulin, dalanated: D04546
Insulin, isophane: D04547
Proinsulin human: D05622
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    3643 (INSR)
   04015 Rap1 signaling pathway
    3643 (INSR)
   04010 MAPK signaling pathway
    3643 (INSR)
   04066 HIF-1 signaling pathway
    3643 (INSR)
   04068 FoxO signaling pathway
    3643 (INSR)
   04072 Phospholipase D signaling pathway
    3643 (INSR)
   04022 cGMP - PKG signaling pathway
    3643 (INSR)
   04151 PI3K-Akt signaling pathway
    3643 (INSR)
   04152 AMPK signaling pathway
    3643 (INSR)
   04150 mTOR signaling pathway
    3643 (INSR)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    3643 (INSR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    3643 (INSR)
   04923 Regulation of lipolysis in adipocyte
    3643 (INSR)
   04913 Ovarian Steroidogenesis
    3643 (INSR)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    3643 (INSR)
  Aging
   04211 Longevity regulating pathway - mammal
    3643 (INSR)
   04213 Longevity regulating pathway - multiple species
    3643 (INSR)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    3643 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    3643 (INSR)
   04931 Insulin resistance
    3643 (INSR)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     3643 (INSR)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases
  INSR family [OT]
   3643 (INSR)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class II (Insulin receptor family)
   3643 (INSR)
CD molecules [BR:hsa04090]
 Proteins
  3643 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like B2 DUF4476
Motif
Other DBs
NCBI-GeneID: 3643
NCBI-ProteinID: NP_000199
OMIM: 147670
HGNC: 6091
Ensembl: ENSG00000171105
Vega: OTTHUMG00000181992
Pharos: P06213(Tclin)
UniProt: P06213
LinkDB All DBs
Structure
PDB: 

Jmol
Position
19p13.2
AA seq 1382 aa AA seqDB search
MATGGRRGAAAAPLLVAVAALLLGAAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHSECL
GNCSQPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHHKCKNSRRQG
CHQYVIHNNKCIPECPSGYTMNSSNLLCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGC
TVINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETL
EIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQE
RNDIALKTNGDQASCENELLKFSYIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDIDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFS
DERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWE
RQAEDSELFELDYCLKGLKLPSRTWSPPFESEDSQKHNQSEYEDSAGECCSCPKTDSQIL
KELEESSFRKTFEDYLHNVVFVPRKTSSGTGAEDPRPSRKRRSLGDVGNVTVAVPTVAAF
PNTSSTSVPTSPEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDTPEERCSVAAYV
SARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCV
SRKHFALERGCRLRGLSPGNYSVRIRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKIIIG
PLIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVSR
EKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKG
FTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMA
AEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPV
RWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDN
CPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENKAPESEELEME
FEDMENVPLDRSSHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSN
PS
NT seq 4149 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgggggccggcggggggcggcggccgcgccgctgctggtggcggtggccgcg
ctgctactgggcgccgcgggccacctgtaccccggagaggtgtgtcccggcatggatatc
cggaacaacctcactaggttgcatgagctggagaattgctctgtcatcgaaggacacttg
cagatactcttgatgttcaaaacgaggcccgaagatttccgagacctcagtttccccaaa
ctcatcatgatcactgattacttgctgctcttccgggtctatgggctcgagagcctgaag
gacctgttccccaacctcacggtcatccggggatcacgactgttctttaactacgcgctg
gtcatcttcgagatggttcacctcaaggaactcggcctctacaacctgatgaacatcacc
cggggttctgtccgcatcgagaagaacaatgagctctgttacttggccactatcgactgg
tcccgtatcctggattccgtggaggataattacatcgtgttgaacaaagatgacaacgag
gagtgtggagacatctgtccgggtaccgcgaagggcaagaccaactgccccgccaccgtc
atcaacgggcagtttgtcgaacgatgttggactcatagtcactgccagaaagtttgcccg
accatctgtaagtcacacggctgcaccgccgaaggcctctgttgccacagcgagtgcctg
ggcaactgttctcagcccgacgaccccaccaagtgcgtggcctgccgcaacttctacctg
gacggcaggtgtgtggagacctgcccgcccccgtactaccacttccaggactggcgctgt
gtgaacttcagcttctgccaggacctgcaccacaaatgcaagaactcgcggaggcagggc
tgccaccagtacgtcattcacaacaacaagtgcatccctgagtgtccctccgggtacacg
atgaattccagcaacttgctgtgcaccccatgcctgggtccctgtcccaaggtgtgccac
ctcctagaaggcgagaagaccatcgactcggtgacgtctgcccaggagctccgaggatgc
accgtcatcaacgggagtctgatcatcaacattcgaggaggcaacaatctggcagctgag
ctagaagccaacctcggcctcattgaagaaatttcagggtatctaaaaatccgccgatcc
tacgctctggtgtcactttccttcttccggaagttacgtctgattcgaggagagaccttg
gaaattgggaactactccttctatgccttggacaaccagaacctaaggcagctctgggac
tggagcaaacacaacctcaccatcactcaggggaaactcttcttccactataaccccaaa
ctctgcttgtcagaaatccacaagatggaagaagtttcaggaaccaaggggcgccaggag
agaaacgacattgccctgaagaccaatggggaccaggcatcctgtgaaaatgagttactt
aaattttcttacattcggacatcttttgacaagatcttgctgagatgggagccgtactgg
ccccccgacttccgagacctcttggggttcatgctgttctacaaagaggccccttatcag
aatgtgacggagttcgacgggcaggatgcgtgtggttccaacagttggacggtggtagac
attgacccacccctgaggtccaacgaccccaaatcacagaaccacccagggtggctgatg
cggggtctcaagccctggacccagtatgccatctttgtgaagaccctggtcaccttttcg
gatgaacgccggacctatggggccaagagtgacatcatttatgtccagacagatgccacc
aacccctctgtgcccctggatccaatctcagtgtctaactcatcatcccagattattctg
aagtggaaaccaccctccgaccccaatggcaacatcacccactacctggttttctgggag
aggcaggcggaagacagtgagctgttcgagctggattattgcctcaaagggctgaagctg
ccctcgaggacctggtctccaccattcgagtctgaagattctcagaagcacaaccagagt
gagtatgaggattcggccggcgaatgctgctcctgtccaaagacagactctcagatcctg
aaggagctggaggagtcctcgtttaggaagacgtttgaggattacctgcacaacgtggtt
ttcgtccccagaaaaacctcttcaggcactggtgccgaggaccctaggccatctcggaaa
cgcaggtcccttggcgatgttgggaatgtgacggtggccgtgcccacggtggcagctttc
cccaacacttcctcgaccagcgtgcccacgagtccggaggagcacaggccttttgagaag
gtggtgaacaaggagtcgctggtcatctccggcttgcgacacttcacgggctatcgcatc
gagctgcaggcttgcaaccaggacacccctgaggaacggtgcagtgtggcagcctacgtc
agtgcgaggaccatgcctgaagccaaggctgatgacattgttggccctgtgacgcatgaa
atctttgagaacaacgtcgtccacttgatgtggcaggagccgaaggagcccaatggtctg
atcgtgctgtatgaagtgagttatcggcgatatggtgatgaggagctgcatctctgcgtc
tcccgcaagcacttcgctctggaacggggctgcaggctgcgtgggctgtcaccggggaac
tacagcgtgcgaatccgggccacctcccttgcgggcaacggctcttggacggaacccacc
tatttctacgtgacagactatttagacgtcccgtcaaatattgcaaaaattatcatcggc
cccctcatctttgtctttctcttcagtgttgtgattggaagtatttatctattcctgaga
aagaggcagccagatgggccgctgggaccgctttacgcttcttcaaaccctgagtatctc
agtgccagtgatgtgtttccatgctctgtgtacgtgccggacgagtgggaggtgtctcga
gagaagatcaccctccttcgagagctggggcagggctccttcggcatggtgtatgagggc
aatgccagggacatcatcaagggtgaggcagagacccgcgtggcggtgaagacggtcaac
gagtcagccagtctccgagagcggattgagttcctcaatgaggcctcggtcatgaagggc
ttcacctgccatcacgtggtgcgcctcctgggagtggtgtccaagggccagcccacgctg
gtggtgatggagctgatggctcacggagacctgaagagctacctccgttctctgcggcca
gaggctgagaataatcctggccgccctccccctacccttcaagagatgattcagatggcg
gcagagattgctgacgggatggcctacctgaacgccaagaagtttgtgcatcgggacctg
gcagcgagaaactgcatggtcgcccatgattttactgtcaaaattggagactttggaatg
accagagacatctatgaaacggattactaccggaaagggggcaagggtctgctccctgta
cggtggatggcaccggagtccctgaaggatggggtcttcaccacttcttctgacatgtgg
tcctttggcgtggtcctttgggaaatcaccagcttggcagaacagccttaccaaggcctg
tctaatgaacaggtgttgaaatttgtcatggatggagggtatctggatcaacccgacaac
tgtccagagagagtcactgacctcatgcgcatgtgctggcaattcaaccccaagatgagg
ccaaccttcctggagattgtcaacctgctcaaggacgacctgcaccccagctttccagag
gtgtcgttcttccacagcgaggagaacaaggctcccgagagtgaggagctggagatggag
tttgaggacatggagaatgtgcccctggaccgttcctcgcactgtcagagggaggaggcg
gggggccgggatggagggtcctcgctgggtttcaagcggagctacgaggaacacatccct
tacacacacatgaacggaggcaagaaaaacgggcggattctgaccttgcctcggtccaat
ccttcctaa

DBGET integrated database retrieval system