KEGG   Homo sapiens (human): 3669Help
Entry
3669              CDS       T01001                                 

Gene name
ISG20, CD25, HEM45
Definition
interferon stimulated exonuclease gene 20kDa (EC:3.1.13.1)
Orthology
K12579  
interferon-stimulated gene 20 kDa protein [EC:3.1.13.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     3669 (ISG20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
15q26
AA seq 181 aa AA seqDB search
MAGSREVVAMDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVT
PQHMVGATPFAVARLEILQLLKGKLVVGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREA
KLDHCRRVSLRVLSERLLHKSIQNSLLGHSSVEDARATMELYQISQRIRARRGLPRLAVS
D
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggctgggagccgtgaggtggtggccatggactgcgagatggtggggctggggccccac
cgggagagtggcctggctcgttgcagcctcgtgaacgtccacggtgctgtgctgtacgac
aagttcatccggcctgagggagagatcaccgattacagaacccgggtcagcggggtcacc
cctcagcacatggtgggggccacaccatttgccgtggccaggctagagatcctgcagctc
ctgaaaggcaagctggtggtgggtcatgacctgaagcacgacttccaggcactgaaagag
gacatgagcggctacacaatctacgacacgtccactgacaggctgttgtggcgtgaggcc
aagctggaccactgcaggcgtgtctccctgcgggtgctgagtgagcgcctcctgcacaag
agcatccagaacagcctgcttggacacagctcggtggaagatgcgagggcaacgatggag
ctctatcaaatctcccagagaatccgagcccgccgagggctgccccgcctggctgtgtca
gactga

DBGET integrated database retrieval system