KEGG   Homo sapiens (human): 435Help
Entry
435               CDS       T01001                                 

Gene name
ASL, ASAL
Definition
argininosuccinate lyase (EC:4.3.2.1)
Orthology
K01755  
argininosuccinate lyase [EC:4.3.2.1]
Organism
hsa  Homo sapiens (human)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Urea cycle
Disease
H01028  
Argininosuccinic aciduria (ARGINSA)
H01398  
Primary hyperammonemic disorders
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    435 (ASL)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    435 (ASL)
   00330 Arginine and proline metabolism
    435 (ASL)
Enzymes [BR:hsa01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.1  argininosuccinate lyase
     435 (ASL)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   435 (ASL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
7q11.21
AA seq 464 aa AA seqDB search
MASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEM
DQILHGLDKVAEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTD
LRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVAL
TRDSERLLEVRKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVA
EFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKA
GRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVISTLQIHQENM
GQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLF
SGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggcctcggagagtgggaagctttggggtggccggtttgtgggtgcagtggaccccatc
atggagaagttcaacgcgtccattgcctacgaccggcacctttgggaggtggatgttcaa
ggcagcaaagcctacagcaggggcctggagaaggcagggctcctcaccaaggccgagatg
gaccagatactccatggcctagacaaggtggctgaggagtgggcccagggcaccttcaaa
ctgaactccaatgatgaggacatccacacagccaatgagcgccgcctgaaggagctcatt
ggtgcaacggcagggaagctgcacacgggacggagccggaatgaccaggtggtcacagac
ctcaggctgtggatgcggcagacctgctccacgctctcgggcctcctctgggagctcatt
aggaccatggtggatcgggcagaggcggaacgtgatgttctcttcccggggtacacccat
ttgcagagggcccagcccatccgctggagccactggattctgagccacgccgtggcactg
acccgagactctgagcggctgctggaggtgcggaagcggatcaatgtcctgcccctgggg
agtggggccattgcaggcaatcccctgggtgtggaccgagagctgctccgagcagaactc
aactttggggccatcactctcaacagcatggatgccactagtgagcgggactttgtggcc
gagttcctgttctgggcttcgctgtgcatgacccatctcagcaggatggccgaggacctc
atcctctactgcaccaaggaattcagcttcgtgcagctctcagatgcctacagcacggga
agcagcctgatgccccagaagaaaaaccccgacagtttggagctgatccggagcaaggct
gggcgtgtgtttgggcggtgtgccgggctcctgatgaccctcaagggacttcccagcacc
tacaacaaagacttacaggaggacaaggaagctgtgtttgaagtgtcagacactatgagt
gccgtgctccaggtggccactggcgtcatctctacgctgcagattcaccaagagaacatg
ggacaggctctcagccccgacatgctggccactgaccttgcctattacctggtccgcaaa
gggatgccattccgccaggcccacgaggcctccgggaaagctgtgttcatggccgagacc
aagggggtcgccctcaaccagctgtcactgcaggagctgcagaccatcagccccctgttc
tcgggcgacgtgatctgcgtgtgggactacgggcacagtgtggagcagtatggtgccctg
ggcggcactgcgcgctccagcgtcgactggcagatccgccaggtgcgggcgctactgcag
gcacagcaggcctag

DBGET integrated database retrieval system