KEGG   Homo sapiens (human): 445Help
Entry
445               CDS       T01001                                 

Gene name
ASS1, ASS, CTLN1
Definition
argininosuccinate synthase 1 (EC:6.3.4.5)
Orthology
K01940  
argininosuccinate synthase [EC:6.3.4.5]
Organism
hsa  Homo sapiens (human)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Urea cycle
Disease
H00185  
Citrullinemia (CTLN)
H01398  
Primary hyperammonemic disorders
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    445 (ASS1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    445 (ASS1)
   00330 Arginine and proline metabolism
    445 (ASS1)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.5  argininosuccinate synthase
     445 (ASS1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   445 (ASS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
9q34.1
AA seq 412 aa AA seqDB search
MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVF
IEDVSREFVEEFIWPAIQSSALYEDRYLLGTSLARPCIARKQVEIAQREGAKYVSHGATG
KGNDQVRFELSCYSLAPQIKVIAPWRMPEFYNRFKGRNDLMEYAKQHGIPIPVTPKNPWS
MDENLMHISYEAGILENPKNQAPPGLYTKTQDPAKAPNTPDILEIEFKKGVPVKVTNVKD
GTTHQTSLELFMYLNEVAGKHGVGRIDIVENRFIGMKSRGIYETPAGTILYHAHLDIEAF
TMDREVRKIKQGLGLKFAELVYTGFWHSPECEFVRHCIAKSQERVEGKVQVSVLKGQVYI
LGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRLKEYHRLQSKVTAK
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcaaaggctccgtggttctggcctacagtggcggcctggacacctcgtgcatc
ctcgtgtggctgaaggaacaaggctatgacgtcattgcctatctggccaacattggccag
aaggaagacttcgaggaagccaggaagaaggcactgaagcttggggccaaaaaggtgttc
attgaggatgtcagcagggagtttgtggaggagttcatctggccggccatccagtccagc
gcactgtatgaggaccgctacctcctgggcacctctcttgccaggccctgcatcgcccgc
aaacaagtggaaatcgcccagcgggagggggccaagtatgtgtcccacggcgccacagga
aaggggaacgatcaggtccggtttgagctcagctgctactcactggccccccagataaag
gtcattgctccctggaggatgcctgaattctacaaccggttcaagggccgcaatgacctg
atggagtacgcaaagcaacacgggattcccatcccggtcactcccaagaacccgtggagc
atggatgagaacctcatgcacatcagctacgaggctggaatcctggagaaccccaagaac
caagcgcctccaggtctctacacgaagacccaggacccagccaaagcccccaacacccct
gacattctcgagatcgagttcaaaaaaggggtccctgtgaaggtgaccaacgtcaaggat
ggcaccacccaccagacctccttggagctcttcatgtacctgaacgaagtcgcgggcaag
catggcgtgggccgtattgacatcgtggagaaccgcttcattggaatgaagtcccgaggt
atctacgagaccccagcaggcaccatcctttaccatgctcatttagacatcgaggccttc
accatggaccgggaagtgcgcaaaatcaaacaaggcctgggcttgaaatttgctgagctg
gtgtataccggtttctggcacagccctgagtgtgaatttgtccgccactgcatcgccaag
tcccaggagcgagtggaagggaaagtgcaggtgtccgtcctcaagggccaggtgtacatc
ctcggccgggagtccccactgtctctctacaatgaggagctggtgagcatgaacgtgcag
ggtgattatgagccaactgatgccaccgggttcatcaacatcaattccctcaggctgaag
gaatatcatcgtctccagagcaaggtcactgccaaatag

DBGET integrated database retrieval system