KEGG   Homo sapiens (human): 5009Help
Entry
5009              CDS       T01001                                 

Gene name
OTC, OCTD
Definition
(RefSeq) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00220  Arginine biosynthesis
hsa01100  Metabolic pathways
hsa01230  Biosynthesis of amino acids
Module
hsa_M00029  Urea cycle
hsa_M00844  Arginine biosynthesis, ornithine => arginine
Disease
H00187  Ornithine transcarbamylase deficiency
H01398  Primary hyperammonemic disorders (Urea cycle disorders)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    5009 (OTC)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     5009 (OTC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-GeneID: 5009
NCBI-ProteinID: NP_000522
OMIM: 300461
HGNC: 8512
Ensembl: ENSG00000036473
Vega: OTTHUMG00000022727
Pharos: P00480(Tchem)
UniProt: P00480
LinkDB All DBs
Structure
PDB: 

Jmol
Position
Xp11.4
AA seq 354 aa AA seqDB search
MLFNLRILLNNAAFRNGHNFMVRNFRCGQPLQNKVQLKGRDLLTLKNFTGEEIKYMLWLS
ADLKFRIKQKGEYLPLLQGKSLGMIFEKRSTRTRLSTETGFALLGGHPCFLTTQDIHLGV
NESLTDTARVLSSMADAVLARVYKQSDLDTLAKEASIPIINGLSDLYHPIQILADYLTLQ
EHYSSLKGLTLSWIGDGNNILHSIMMSAAKFGMHLQAATPKGYEPDASVTKLAEQYAKEN
GTKLLLTNDPLEAAHGGNVLITDTWISMGQEEEKKKRLQAFQGYQVTMKTAKVAASDWTF
LHCLPRKPEEVDDEVFYSPRSLVFPEAENRKWTIMAVMVSLLTDYSPQLQKPKF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgctgtttaatctgaggatcctgttaaacaatgcagcttttagaaatggtcacaacttc
atggttcgaaattttcggtgtggacaaccactacaaaataaagtgcagctgaagggccgt
gaccttctcactctaaaaaactttaccggagaagaaattaaatatatgctatggctatca
gcagatctgaaatttaggataaaacagaaaggagagtatttgcctttattgcaagggaag
tccttaggcatgatttttgagaaaagaagtactcgaacaagattgtctacagaaacaggc
tttgcacttctgggaggacatccttgttttcttaccacacaagatattcatttgggtgtg
aatgaaagtctcacggacacggcccgtgtattgtctagcatggcagatgcagtattggct
cgagtgtataaacaatcagatttggacaccctggctaaagaagcatccatcccaattatc
aatgggctgtcagatttgtaccatcctatccagatcctggctgattacctcacgctccag
gaacactatagctctctgaaaggtcttaccctcagctggatcggggatgggaacaatatc
ctgcactccatcatgatgagcgcagcgaaattcggaatgcaccttcaggcagctactcca
aagggttatgagccggatgctagtgtaaccaagttggcagagcagtatgccaaagagaat
ggtaccaagctgttgctgacaaatgatccattggaagcagcgcatggaggcaatgtatta
attacagacacttggataagcatgggacaagaagaggagaagaaaaagcggctccaggct
ttccaaggttaccaggttacaatgaagactgctaaagttgctgcctctgactggacattt
ttacactgcttgcccagaaagccagaagaagtggatgatgaagtcttttattctcctcga
tcactagtgttcccagaggcagaaaacagaaagtggacaatcatggctgtcatggtgtcc
ctgctgacagattactcacctcagctccagaagcctaaattttga

DBGET integrated database retrieval system