KEGG   Homo sapiens (human): 51706Help
Entry
51706             CDS       T01001                                 

Gene name
CYB5R1, B5R.1, B5R1, B5R2, NQO3A2, humb5R2
Definition
cytochrome b5 reductase 1 (EC:1.6.2.2)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    51706 (CYB5R1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     51706 (CYB5R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
1q32.1
AA seq 305 aa AA seqDB search
MGIQTSPVLLASLGVGLVTLLGLAVGSYLVRRSRRPQVTLLDPNEKYLLRLLDKTTVSHN
TKRFRFALPTAHHTLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKG
VHPKFPEGGKMSQYLDSLKVGDVVEFRGPSGLLTYTGKGHFNIQPNKKSPPEPRVAKKLG
MIAGGTGITPMLQLIRAILKVPEDPTQCFLLFANQTEKDIILREDLEELQARYPNRFKLW
FTLDHPPKDWAYSKGFVTADMIREHLPAPGDDVLVLLCGPPPMVQLACHPNLDKLGYSQK
MRFTY
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggggatccagacgagccccgtcctgctggcctccctgggggtggggctggtcactctg
ctcggcctggctgtgggctcctacttggttcggaggtcccgccggcctcaggtcactctc
ctggaccccaatgaaaagtacctgctacgactgctagacaagacgactgtgagccacaac
accaagaggttccgctttgccctgcccaccgcccaccacactctggggctgcctgtgggc
aaacatatctacctctccacccgaattgatggcagcctggtcatcaggccatacactcct
gtcaccagtgatgaggatcaaggctatgtggatcttgtcatcaaggtctacctgaagggt
gtgcaccccaaatttcctgagggagggaagatgtctcagtacctggatagcctgaaggtt
ggggatgtggtggagtttcgggggccaagcgggttgctcacttacactggaaaagggcat
tttaacattcagcccaacaagaaatctccaccagaaccccgagtggcgaagaaactggga
atgattgccggcgggacaggaatcaccccaatgctacagctgatccgggccatcctgaaa
gtccctgaagatccaacccagtgctttctgctttttgccaaccagacagaaaaggatatc
atcttgcgggaggacttagaggaactgcaggcccgctatcccaatcgctttaagctctgg
ttcactctggatcatcccccaaaagattgggcctacagcaagggctttgtgactgccgac
atgatccgggaacacctgcccgctccaggggatgatgtgctggtactgctttgtgggcca
cccccaatggtgcagctggcctgccatcccaacttggacaaactgggctactcacaaaag
atgcgattcacctactga

KEGG   Homo sapiens (human): 51700Help
Entry
51700             CDS       T01001                                 

Gene name
CYB5R2, B5R.2
Definition
cytochrome b5 reductase 2 (EC:1.6.2.2)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    51700 (CYB5R2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     51700 (CYB5R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
11p15.4
AA seq 276 aa AA seqDB search
MNSRRREPITLQDPEAKYPLPLIEKEKISHNTRRFRFGLPSPDHVLGLPVGNYVQLLAKI
DNELVVRAYTPVSSDDDRGFVDLIIKIYFKNVHPQYPEGGKMTQYLENMKIGETIFFRGP
RGRLFYHGPGNLGIRPDQTSEPKKTLADHLGMIAGGTGITPMLQLIRHITKDPSDRTRMS
LIFANQTEEDILVRKELEEIARTHPDQFNLWYTLDRPPIGWKYSSGFVTADMIKEHLPPP
AKSTLILVCGPPPLIQTAAHPNLEKLGYTQDMIFTY
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaactccaggaggagagagccaatcaccttacaggaccctgaagccaagtacccgctg
cccttgattgagaaagagaaaatcagccacaacacccggaggttccgctttggactgcct
tcgccggaccatgtcttagggcttcctgtaggtaactatgtccagctcttggcaaaaatc
gataatgaattggtggtcagggcttacacccctgtctccagtgatgatgacagaggcttt
gtggacctaattataaagatctacttcaaaaatgtacacccccaatatcctgaaggtggg
aagatgactcagtatttggagaacatgaaaatcggggagaccatcttttttcgagggcca
aggggacgcttgttttaccatgggccagggaatcttggaatcagaccagaccagacgagt
gagcctaaaaaaacactggccgatcacctgggaatgattgctgggggcacaggcatcaca
cccatgttgcagctcattcgccacatcaccaaggaccccagtgacaggaccaggatgtcc
ctcatctttgccaaccagacagaggaggatatcttggtcagaaaagagcttgaagaaatt
gccaggactcacccagaccagttcaacctgtggtacaccctggacaggcctcccattggc
tggaagtacagctcaggcttcgttactgccgacatgatcaaggagcaccttcctcctcca
gcgaagtccacgctcatcctggtgtgtggcccgccaccactaatccagacggcggctcac
cctaacctggagaagctgggttatacccaggacatgattttcacctactaa

KEGG   Homo sapiens (human): 1727Help
Entry
1727              CDS       T01001                                 

Gene name
CYB5R3, B5R, DIA1
Definition
cytochrome b5 reductase 3 (EC:1.6.2.2)
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
Amino sugar and nucleotide sugar metabolism
Disease
H00235  
Methemoglobinemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    1727 (CYB5R3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     1727 (CYB5R3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
22q13.2
AA seq 301 aa AA seqDB search
MGAQLSTLGHMVLFPVWFLYSLLMKLFQRSTPAITLESPDIKYPLRLIDREIISHDTRRF
RFALPSPQHILGLPVGQHIYLSARIDGNLVVRPYTPISSDDDKGFVDLVIKVYFKDTHPK
FPAGGKMSQYLESMQIGDTIEFRGPSGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGMIAG
GTGITPMLQVIRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLD
RAPEAWDYGQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMIQYACLPNLDHVGHPTERCFV
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgggggcccagctcagcacgttgggccatatggtgctcttcccagtctggttcctgtac
agtctgctcatgaagctgttccagcgctccacgccagccatcaccctcgagagcccggac
atcaagtacccgctgcggctcatcgaccgggagatcatcagccatgacacccggcgcttc
cgctttgccctgccgtcaccccagcacatcctgggcctccctgtcggccagcacatctac
ctctcggctcgaattgatggaaacctggtcgtccggccctatacacccatctccagcgat
gatgacaagggcttcgtggacctggtcatcaaggtttacttcaaggacacccatcccaag
tttcccgctggagggaagatgtctcagtacctggagagcatgcagattggagacaccatt
gagttccggggccccagtgggctgctggtctaccagggcaaagggaagttcgccatccga
cctgacaaaaagtccaaccctatcatcaggacagtgaagtctgtgggcatgatcgcggga
gggacaggcatcaccccgatgctgcaggtgatccgcgccatcatgaaggaccctgatgac
cacactgtgtgccacctgctctttgccaaccagaccgagaaggacatcctgctgcgacct
gagctggaggaactcaggaacaaacattctgcacgcttcaagctctggtacacgctggac
agagcccctgaagcctgggactacggccagggcttcgtgaatgaggagatgatccgggac
caccttccacccccagaggaggagccgctggtgctgatgtgtggccccccacccatgatc
cagtacgcctgccttcccaacctggaccacgtgggccaccccacggagcgctgcttcgtc
ttctga

KEGG   Homo sapiens (human): 51167Help
Entry
51167             CDS       T01001                                 

Gene name
CYB5R4, NCB5OR, cb5/cb5R, dJ676J13.1
Definition
cytochrome b5 reductase 4 (EC:1.6.2.2)
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
6pter-q22.33
AA seq 521 aa AA seqDB search
MLNVPSQSFPAPRSQQRVASGGRSKVPLKQGRSLMDWIRLTKSGKDLTGLKGRLIEVTEE
ELKKHNKKDDCWICIRGFVYNVSPYMEYHPGGEDELMRAAGSDGTELFDQVHRWVNYESM
LKECLVGRMAIKPAVLKDYREEEKKVLNGMLPKSQVTDTLAKEGPSYPSYDWFQTDSLVT
IAIYTKQKDINLDSIIVDHQNDSFRAETIIKDCLYLIHIGLSHEVQEDFSVRVVESVGKI
EIVLQKKENTSWDFLGHPLKNHNSLIPRKDTGLYYRKCQLISKEDVTHDTRLFCLMLPPS
THLQVPIGQHVYLKLPITGTEIVKPYTPVSGSLLSEFKEPVLPNNKYIYFLIKIYPTGLF
TPELDRLQIGDFVSVSSPEGNFKISKFQELEDLFLLAAGTGFTPMVKILNYALTDIPSLR
KVKLMFFNKTEDDIIWRSQLEKLAFKDKRLDVEFVLSAPISEWNGKQGHISPALLSEFLK
RNLDKSKVLVCICGPVPFTEQGVRLLHDLNFSKNEIHSFTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctgaacgtcccttcccagtctttcccggcccccaggtcgcagcagcgtgtcgcctcc
ggggggcgtagcaaggtacctttaaaacagggcagaagccttatggattggattcgactg
accaaaagtggaaaggatctaacgggattaaaaggcaggttaattgaagtaactgaagaa
gaacttaagaaacacaacaaaaaagatgattgttggatatgcataagaggtttcgtttat
aatgtcagcccttatatggagtatcatcctggtggagaagatgaactaatgagagcagca
ggatcagatggtactgaactttttgatcaggttcatcgttgggtcaattatgaatccatg
ctgaaagaatgcctggttggcagaatggccattaaacctgctgttctgaaagactatcgt
gaggaggaaaagaaagtcttaaatggcatgcttcccaagagccaagtgacagatacactt
gccaaagaaggtcctagttatccaagctatgattggttccaaacagactctttagtcacc
attgccatatatactaaacagaaggatatcaatttagactcaataatagttgatcatcag
aatgattcctttagagcagaaacaattattaaggattgtttatatcttatacatattggg
ctaagccatgaggttcaggaagatttttctgtgcgggttgttgagagtgtgggaaaaata
gagattgttctacaaaaaaaagagaatacttcttgggactttcttggccatcccctgaag
aatcataattcacttattccaaggaaagatacaggtttgtactacagaaagtgccagtta
atttccaaggaagatgttactcatgatacgaggcttttctgtttgatgctgccaccaagc
actcatcttcaagtgcccattgggcaacatgtttacctcaagctacctattacaggtaca
gaaatagtaaagccatatacacctgtatctggttccttactctcagagttcaaggaacca
gttcttcccaacaataaatacatctactttttgataaaaatctatcccactggactcttc
acaccagagcttgatcgtcttcagattggagattttgtttctgtaagcagtcctgagggc
aattttaaaatatccaagttccaagaattagaagatctctttttgttggcagctggaaca
ggcttcacaccaatggttaaaatactgaattatgctttgactgatatacccagtctcagg
aaagtgaagctgatgttcttcaataaaacagaagatgatataatttggagaagccaattg
gagaaattagcatttaaagataaaagactggatgttgaatttgttctctcagcacctatt
tctgaatggaatggcaaacagggacatatttcaccagctcttctttctgaatttttgaaa
agaaatttggacaaatccaaagttctcgtctgcatttgtggaccagtgccatttacagaa
caaggagtaaggttgctgcatgatctcaacttttccaaaaatgagatccatagttttaca
gcataa

DBGET integrated database retrieval system