KEGG   Homo sapiens (human): 5241Help
Entry
5241              CDS       T01001                                 

Gene name
PGR, NR3C3, PR
Definition
progesterone receptor
Orthology
K08556  
progesterone receptor
Organism
hsa  Homo sapiens (human)
Pathway
Oocyte meiosis
Progesterone-mediated oocyte maturation
Drug target
Norethisterone: 
Lynestrenol: 
Levonorgestrel: 
Quingestanol: 
Megestrol: 
Medroxyprogesterone: 
Norgestrienone: 
Etonogestrel: 
Desogestrel: 
Ulipristal: 
Gestonorone: 
Hydroxyprogesterone: 
Progesterone: 
Dydrogesterone: 
Medrogestone: 
Nomegestrol: 
Demegestone: 
Chlormadinone: 
Promegestone: 
Dienogest: 
Allylestrenol: 
Etynodiol: 
Danazol: 
Mifepristone: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    5241 (PGR)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    5241 (PGR)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 estrogen-like
    5241 (PGR)
Nuclear receptors [BR:hsa03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   5241 (PGR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
11q22-q23
AA seq 933 aa AA seqDB search
MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLF
PRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGLLDSVLDTLLA
PSGPGQSQPSPPACEVTSSWCLFGPELPEDPPAAPATQRVLSPLMSRSGCKVGDSSGTAA
AHKVLPRGLSPARQLLLPASESPHWSGAPVKPSPQAAAVEVEEEDGSESEESAGPLLKGK
PRALGGAAAGGGAAAVPPGAAAGGVALVPKEDSRFSAPRVALVEQDAPMAPGRSPLATTV
MDFIHVPILPLNHALLAARTRQLLEDESYDGGAGAASAFAPPRSSPCASSTPVAVGDFPD
CAYPPDAEPKDDAYPLYSDFQPPALKIKEEEEGAEASARSPRSYLVAGANPAAFPDFPLG
PPPPLPPRATPSRPGEAAVTAAPASASVSSASSSGSTLECILYKAEGAPPQQGPFAPPPC
KAPGASGCLLPRDGLPSTSASAAAAGAAPALYPALGLNGLPQLGYQAAVLKEGLPQVYPP
YLNYLRPDSEASQSPQYSFESLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHN
YLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVVRALDAVALPQPV
GVPNESQALSQRFTFSPGQDIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQ
LGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAP
DLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQ
FEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRA
LSVEFPEMMSEVIAAQLPKILAGMVKPLLFHKK
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atgactgagctgaaggcaaagggtccccgggctccccacgtggcgggcggcccgccctcc
cccgaggtcggatccccactgctgtgtcgcccagccgcaggtccgttcccggggagccag
acctcggacaccttgcctgaagtttcggccatacctatctccctggacgggctactcttc
cctcggccctgccagggacaggacccctccgacgaaaagacgcaggaccagcagtcgctg
tcggacgtggagggcgcatattccagagctgaagctacaaggggtgctggaggcagcagt
tctagtcccccagaaaaggacagcggactgctggacagtgtcttggacactctgttggcg
ccctcaggtcccgggcagagccaacccagccctcccgcctgcgaggtcaccagctcttgg
tgcctgtttggccccgaacttcccgaagatccaccggctgcccccgccacccagcgggtg
ttgtccccgctcatgagccggtccgggtgcaaggttggagacagctccgggacggcagct
gcccataaagtgctgccccggggcctgtcaccagcccggcagctgctgctcccggcctct
gagagccctcactggtccggggccccagtgaagccgtctccgcaggccgctgcggtggag
gttgaggaggaggatggctctgagtccgaggagtctgcgggtccgcttctgaagggcaaa
cctcgggctctgggtggcgcggcggctggaggaggagccgcggctgtcccgccgggggcg
gcagcaggaggcgtcgccctggtccccaaggaagattcccgcttctcagcgcccagggtc
gccctggtggagcaggacgcgccgatggcgcccgggcgctccccgctggccaccacggtg
atggatttcatccacgtgcctatcctgcctctcaatcacgccttattggcagcccgcact
cggcagctgctggaagacgaaagttacgacggcggggccggggctgccagcgcctttgcc
ccgccgcggagttcaccctgtgcctcgtccaccccggtcgctgtaggcgacttccccgac
tgcgcgtacccgcccgacgccgagcccaaggacgacgcgtaccctctctatagcgacttc
cagccgcccgctctaaagataaaggaggaggaggaaggcgcggaggcctccgcgcgctcc
ccgcgttcctaccttgtggccggtgccaaccccgcagccttcccggatttcccgttgggg
ccaccgcccccgctgccgccgcgagcgaccccatccagacccggggaagcggcggtgacg
gccgcacccgccagtgcctcagtctcgtctgcgtcctcctcggggtcgaccctggagtgc
atcctgtacaaagcggagggcgcgccgccccagcagggcccgttcgcgccgccgccctgc
aaggcgccgggcgcgagcggctgcctgctcccgcgggacggcctgccctccacctccgcc
tctgccgccgccgccggggcggcccccgcgctctaccctgcactcggcctcaacgggctc
ccgcagctcggctaccaggccgccgtgctcaaggagggcctgccgcaggtctacccgccc
tatctcaactacctgaggccggattcagaagccagccagagcccacaatacagcttcgag
tcattacctcagaagatttgtttaatctgtggggatgaagcatcaggctgtcattatggt
gtccttacctgtgggagctgtaaggtcttctttaagagggcaatggaagggcagcacaac
tacttatgtgctggaagaaatgactgcatcgttgataaaatccgcagaaaaaactgccca
gcatgtcgccttagaaagtgctgtcaggctggcatggtccttggaggtcgaaaatttaaa
aagttcaataaagtcagagttgtgagagcactggatgctgttgctctcccacagccagtg
ggcgttccaaatgaaagccaagccctaagccagagattcactttttcaccaggtcaagac
atacagttgattccaccactgatcaacctgttaatgagcattgaaccagatgtgatctat
gcaggacatgacaacacaaaacctgacacctccagttctttgctgacaagtcttaatcaa
ctaggcgagaggcaacttctttcagtagtcaagtggtctaaatcattgccaggttttcga
aacttacatattgatgaccagataactctcattcagtattcttggatgagcttaatggtg
tttggtctaggatggagatcctacaaacacgtcagtgggcagatgctgtattttgcacct
gatctaatactaaatgaacagcggatgaaagaatcatcattctattcattatgccttacc
atgtggcagatcccacaggagtttgtcaagcttcaagttagccaagaagagttcctctgt
atgaaagtattgttacttcttaatacaattcctttggaagggctacgaagtcaaacccag
tttgaggagatgaggtcaagctacattagagagctcatcaaggcaattggtttgaggcaa
aaaggagttgtgtcgagctcacagcgtttctatcaacttacaaaacttcttgataacttg
catgatcttgtcaaacaacttcatctgtactgcttgaatacatttatccagtcccgggca
ctgagtgttgaatttccagaaatgatgtctgaagttattgctgcacaattacccaagata
ttggcagggatggtgaaaccccttctctttcataaaaagtga

DBGET integrated database retrieval system