KEGG   Homo sapiens (human): 5371Help
Entry
5371              CDS       T01001                                 

Gene name
PML, MYL, PP8675, RNF71, TRIM19
Definition
(RefSeq) promyelocytic leukemia
  KO
K10054  probable transcription factor PML
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04144  Endocytosis
hsa05164  Influenza A
hsa05168  Herpes simplex infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
Network
N00109  PML-RARA fusion to transcriptional activtion
N00113  PML-RARA fusion to transcriptional repression
Disease
H00003  Acute myeloid leukemia (AML)
Drug target
Tretinoin (DG00433): D00094
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    5371 (PML)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    5371 (PML)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5371 (PML)
   05202 Transcriptional misregulation in cancers
    5371 (PML)
   05221 Acute myeloid leukemia
    5371 (PML)
  Infectious diseases
   05164 Influenza A
    5371 (PML)
   05168 Herpes simplex infection
    5371 (PML)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    5371 (PML)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3583 zf-B_box zf-C3HC4_3 Prok-RING_4 zf-RING_5 Imm71 OmpH
Motif
Other DBs
NCBI-GeneID: 5371
NCBI-ProteinID: NP_150241
OMIM: 102578
HGNC: 9113
Ensembl: ENSG00000140464
Vega: OTTHUMG00000137607
Pharos: P29590(Tbio)
UniProt: P29590
LinkDB All DBs
Structure
PDB: 

Jmol
Position
15q24.1
AA seq 882 aa AA seqDB search
MEPAPARSPRPQQDPARPQEPTMPPPETPSEGRQPSPSPSPTERAPASEEEFQFLRCQQC
QAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLGADTPALDNVFFESLQRRLSVYR
QIVDAQAVCTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEARPLAELRNQSVREFLDG
TRKTNNIFCSNPNHRTPTLTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEIQQRQEEL
DAMTQALQEQDSAFGAVHAQMHAAVGQLGRARAETEELIRERVRQVVAHVRAQERELLEA
VDARYQRDYEEMASRLGRLDAVLQRIRTGSALVQRMKCYASDQEVLDMHGFLRQALCRLR
QEEPQSLQAAVRTDGFDEFKVRLQDLSSCITQGKDAAVSKKASPEAASTPRDPIDVDLPE
EAERVKAQVQALGLAEAQPMAVVQSVPGAHPVPVYAFSIKGPSYGEDVSNTTTAQKRKCS
QTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLP
NSNHVASGAGEAEERVVVISSSEDSDAENSSSRELDDSSSESSDLQLEGPSTLRVLDENL
ADPQAEDRPLVFFDLKIDNETQKISQLAAVNRESKFRVVIQPEAFFSIYSKAVSLEVGLQ
HFLSFLSSMRRPILACYKLWGPGLPNFFRALEDINRLWEFQEAISGFLAALPLIRERVPG
ASSFKLKNLAQTYLARNMSERSAMAAVLAMRDLCRLLEVSPGPQLAQHVYPFSSLQCFAS
LQPLVQAAVLPRAEARLLALHNVSFMELLSAHRRDRQGGLKKYSRYLSLQTTTLPPAQPA
FNLQALGTYFEGLLEGPALARAEGVSTPLAGRGLAERASQQS
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atggagcctgcacccgcccgatctccgaggccccagcaggaccccgcccggccccaggag
cccaccatgcctccccccgagaccccctctgaaggccgccagcccagccccagccccagc
cctacagagcgagcccccgcttcggaggaggagttccagtttctgcgctgccagcaatgc
caggcggaagccaagtgcccgaagctgctgccttgtctgcacacgctgtgctcaggatgc
ctggaggcgtcgggcatgcagtgccccatctgccaggcgccctggcccctaggtgcagac
acacccgccctggataacgtctttttcgagagtctgcagcggcgcctgtcggtgtaccgg
cagattgtggatgcgcaggctgtgtgcacccgctgcaaagagtcggccgacttctggtgc
tttgagtgcgagcagctcctctgcgccaagtgcttcgaggcacaccagtggttcctcaag
cacgaggcccggcccctagcagagctgcgcaaccagtcggtgcgtgagttcctggacggc
acccgcaagaccaacaacatcttctgctccaaccccaaccaccgcacccctacgctgacc
agcatctactgccgaggatgttccaagccgctgtgctgctcgtgcgcgctccttgacagc
agccacagtgagctcaagtgcgacatcagcgcagagatccagcagcgacaggaggagctg
gacgccatgacgcaggcgctgcaggagcaggatagtgcctttggcgcggttcacgcgcag
atgcacgcggccgtcggccagctgggccgcgcgcgtgccgagaccgaggagctgatccgc
gagcgcgtgcgccaggtggtagctcacgtgcgggctcaggagcgcgagctgctggaggct
gtggacgcgcggtaccagcgcgactacgaggagatggccagtcggctgggccgcctggat
gctgtgctgcagcgcatccgcacgggcagcgcgctggtgcagaggatgaagtgctacgcc
tcggaccaggaggtgctggacatgcacggtttcctgcgccaggcgctctgccgcctgcgc
caggaggagccccagagcctgcaagctgccgtgcgcaccgatggcttcgacgagttcaag
gtgcgcctgcaggacctcagctcttgcatcacccaggggaaagatgcagctgtatccaag
aaagccagcccagaggctgccagcactcccagggaccctattgacgttgacctgcccgag
gaggcagagagagtgaaggcccaggttcaggccctggggctggctgaagcccagcctatg
gctgtggtacagtcagtgcccggggcacaccccgtgccagtgtacgccttctccatcaaa
ggcccttcctatggagaggatgtctccaatacaacgacagcccagaagaggaagtgcagc
cagacccagtgccccaggaaggtcatcaagatggagtctgaggaggggaaggaggcaagg
ttggctcggagctccccggagcagcccaggcccagcacctccaaggcagtctcaccaccc
cacctggatggaccgcctagccccaggagccccgtcataggaagtgaggtcttcctgccc
aacagcaaccacgtggccagtggcgccggggaggcagaggaacgcgttgtggtgatcagc
agctcggaagactcagatgccgaaaactcgtcctcccgagagctggatgacagcagcagt
gagtccagtgacctccagctggaaggccccagcaccctcagggtcctggacgagaacctt
gctgacccccaagcagaagacagacctctggttttctttgacctcaagattgacaatgaa
acccagaagattagccagctggctgcggtgaaccgggaaagcaagttccgcgtggtcatc
cagcctgaagccttcttcagcatctactccaaggccgtgtccctggaggtggggctgcag
cacttcctcagctttctgagctccatgcgccgccctatcttggcctgctacaagctgtgg
gggcctggcctcccaaacttcttccgggccctggaggacattaacaggctgtgggaattc
caggaggccatctcgggcttcctggctgccctgcctctcatccgggagcgtgtgcccggg
gccagcagcttcaaactcaagaacctggcccagacctacctggcgagaaacatgagcgag
cgcagcgccatggctgccgtgctggccatgcgtgacctgtgccgcctcctcgaggtctcc
ccgggcccccagctggcccagcatgtctaccccttcagtagcctgcagtgctttgcctcc
ctgcagcccctggtgcaggcagctgtgctgccccgggctgaggcccgcctcctggcccta
cacaacgtgagcttcatggagctgctgagtgcacaccgccgtgaccggcaggggggcctg
aagaagtacagccgctatctaagcctgcagaccaccacgttgccccctgcccagcctgct
ttcaacctgcaggctctgggcacctactttgaaggcctgttggagggtccggcgctggca
cgggcagaaggagtctccaccccacttgctggccgtggcttggcagagagggcctcccag
cagagctga

KEGG   Homo sapiens (human): 5914Help
Entry
5914              CDS       T01001                                 

Gene name
RARA, NR1B1, RAR
Definition
(RefSeq) retinoic acid receptor alpha
  KO
K08527  retinoic acid receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04659  Th17 cell differentiation
hsa04915  Estrogen signaling pathway
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
Disease
H00516  Cleft lip and/or cleft palate
Drug target
Acitretin: D02754
Alitretinoin: D02815
Etretinate: D00316
Fenretinide: D04162
Isotretinoin (DG00434): D00348 D04636
Retinol (vit A) (DG00123): D00164 D01621 D06543 D08477
Tamibarotene: D01418
Tazarotene: D01132
Tretinoin (DG00433): D00094
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04659 Th17 cell differentiation
    5914 (RARA)
  Endocrine system
   04915 Estrogen signaling pathway
    5914 (RARA)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5914 (RARA)
   05202 Transcriptional misregulation in cancers
    5914 (RARA)
   05221 Acute myeloid leukemia
    5914 (RARA)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    5914 (RARA)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   5914 (RARA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 5914
NCBI-ProteinID: NP_000955
OMIM: 180240
HGNC: 9864
Ensembl: ENSG00000131759
Vega: OTTHUMG00000133328
Pharos: P10276(Tclin)
UniProt: P10276 Q6I9R7
LinkDB All DBs
Structure
PDB: 

Jmol
Position
17q21.2
AA seq 462 aa AA seqDB search
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPAT
IETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
VYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTL
TPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTV
EFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALK
VYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGL
DTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaacagcagctcctgcccgacacctgggggcgggcacctcaatgggtacccg
gtgcctccctacgccttcttcttcccccctatgctgggtggactctccccgccaggcgct
ctgaccactctccagcaccagcttccagttagtggatatagcacaccatccccagccacc
attgagacccagagcagcagttctgaagagatagtgcccagccctccctcgccaccccct
ctaccccgcatctacaagccttgctttgtctgtcaggacaagtcctcaggctaccactat
ggggtcagcgcctgtgagggctgcaagggcttcttccgccgcagcatccagaagaacatg
gtgtacacgtgtcaccgggacaagaactgcatcatcaacaaggtgacccggaaccgctgc
cagtactgccgactgcagaagtgctttgaagtgggcatgtccaaggagtctgtgagaaac
gaccgaaacaagaagaagaaggaggtgcccaagcccgagtgctctgagagctacacgctg
acgccggaggtgggggagctcattgagaaggtgcgcaaagcgcaccaggaaaccttccct
gccctctgccagctgggcaaatacactacgaacaacagctcagaacaacgtgtctctctg
gacattgacctctgggacaagttcagtgaactctccaccaagtgcatcattaagactgtg
gagttcgccaagcagctgcccggcttcaccaccctcaccatcgccgaccagatcaccctc
ctcaaggctgcctgcctggacatcctgatcctgcggatctgcacgcggtacacgcccgag
caggacaccatgaccttctcggacgggctgaccctgaaccggacccagatgcacaacgct
ggcttcggccccctcaccgacctggtctttgccttcgccaaccagctgctgcccctggag
atggatgatgcggagacggggctgctcagcgccatctgcctcatctgcggagaccgccag
gacctggagcagccggaccgggtggacatgctgcaggagccgctgctggaggcgctaaag
gtctacgtgcggaagcggaggcccagccgcccccacatgttccccaagatgctaatgaag
attactgacctgcgaagcatcagcgccaagggggctgagcgggtgatcacgctgaagatg
gagatcccgggctccatgccgcctctcatccaggaaatgttggagaactcagagggcctg
gacactctgagcggacagccggggggtggggggcgggacgggggtggcctggcccccccg
ccaggcagctgtagccccagcctcagccccagctccaacagaagcagcccggccacccac
tccccgtga

DBGET integrated database retrieval system