KEGG   Homo sapiens (human): 613Help
Entry
613               CDS       T01001                                 

Gene name
BCR, ALL, BCR1, CML, D22S11, D22S662, PHL
Definition
breakpoint cluster region (EC:2.7.11.1)
Orthology
K08878  
breakpoint cluster region protein [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Pathways in cancer
Chronic myeloid leukemia
Disease
H00001  
Acute lymphoblastic leukemia (ALL) (precursor B lymphoblastic leukemia)
H00004  
Chronic myeloid leukemia (CML)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05200 Pathways in cancer
    613 (BCR)
   05220 Chronic myeloid leukemia
    613 (BCR)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     613 (BCR)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Atypical group
  BCR family
   613 (BCR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
22q11.23
AA seq 1271 aa AA seqDB search
MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQ
TLLAKEKKSYDRQRWGFRRAAQAPDGASEPRASASRPQPAPADGADPPPAEEPEARPDGE
GSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNV
EFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSC
GVDGDYEDAELNPRFLKDNLIDANGGSRPPWPPLEYQPYQSIYVGGMMEGEGKGPLLRSQ
STSEQEKRLTWPRRSYSPRSFEDCGGGYTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTY
RMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEG
AFHGDADGSFGTPPGYGCAADRAEEQRRHQDGLPYIDDSPSSSPHLSSKGRGSRDALVSG
ALESTKASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTS
QQIETIFFKVPELYEIHKEFYDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGV
AMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDL
LKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVE
GARKLRHVFLFTDLLLCTKLKKQSGGKTQQYDCKWYIPLTDLSFQMVDELEAVPNIPLVP
DEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRN
GKSYTFLISSDYERAEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTIN
KEDDESPGLYGFLNVIVHSATGFKQSSNLYCTLEVDSFGYFVNKAKTRVYRDTAEPNWNE
EFEIELEGSQTLRILCYEKCYNKTKIPKEDGESTDRLMGKGQVQLDPQALQDRDWQRTVI
AMNGIEVKLSVKFNSREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEIER
RGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLF
TDEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKEAVNKMSL
HNLATVFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLQLEAIPAPDS
KRQSILFSTEV
NT seq 3816 nt NT seq  +upstreamnt  +downstreamnt
atggtggacccggtgggcttcgcggaggcgtggaaggcgcagttcccggactcagagccc
ccgcgcatggagctgcgctcagtgggcgacatcgagcaggagctggagcgctgcaaggcc
tccattcggcgcctggagcaggaggtgaaccaggagcgcttccgcatgatctacctgcag
acgttgctggccaaggaaaagaagagctatgaccggcagcgatggggcttccggcgcgcg
gcgcaggcccccgacggcgcctccgagccccgagcgtccgcgtcgcgcccgcagccagcg
cccgccgacggagccgacccgccgcccgccgaggagcccgaggcccggcccgacggcgag
ggttctccgggtaaggccaggcccgggaccgcccgcaggcccggggcagccgcgtcgggg
gaacgggacgaccggggaccccccgccagcgtggcggcgctcaggtccaacttcgagcgg
atccgcaagggccatggccagcccggggcggacgccgagaagcccttctacgtgaacgtc
gagtttcaccacgagcgcggcctggtgaaggtcaacgacaaagaggtgtcggaccgcatc
agctccctgggcagccaggccatgcagatggagcgcaaaaagtcccagcacggcgcgggc
tcgagcgtgggggatgcatccaggcccccttaccggggacgctcctcggagagcagctgc
ggcgtcgacggcgactacgaggacgccgagttgaacccccgcttcctgaaggacaacctg
atcgacgccaatggcggtagcaggcccccttggccgcccctggagtaccagccctaccag
agcatctacgtcgggggcatgatggaaggggagggcaagggcccgctcctgcgcagccag
agcacctctgagcaggagaagcgccttacctggccccgcaggtcctactccccccggagt
tttgaggattgcggaggcggctataccccggactgcagctccaatgagaacctcacctcc
agcgaggaggacttctcctctggccagtccagccgcgtgtccccaagccccaccacctac
cgcatgttccgggacaaaagccgctctccctcgcagaactcgcaacagtccttcgacagc
agcagtccccccacgccgcagtgccataagcggcaccggcactgcccggttgtcgtgtcc
gaggccaccatcgtgggcgtccgcaagaccgggcagatctggcccaacgatggcgagggc
gccttccatggagacgcagatggctcgttcggaacaccacctggatacggctgcgctgca
gaccgggcagaggagcagcgccggcaccaagatgggctgccctacattgatgactcgccc
tcctcatcgccccacctcagcagcaagggcaggggcagccgggatgcgctggtctcggga
gccctggagtccactaaagcgagtgagctggacttggaaaagggcttggagatgagaaaa
tgggtcctgtcgggaatcctggctagcgaggagacttacctgagccacctggaggcactg
ctgctgcccatgaagcctttgaaagccgctgccaccacctctcagccggtgctgacgagt
cagcagatcgagaccatcttcttcaaagtgcctgagctctacgagatccacaaggagttc
tatgatgggctcttcccccgcgtgcagcagtggagccaccagcagcgggtgggcgacctc
ttccagaagctggccagccagctgggtgtgtaccgggccttcgtggacaactacggagtt
gccatggaaatggctgagaagtgctgtcaggccaatgctcagtttgcagaaatctccgag
aacctgagagccagaagcaacaaagatgccaaggatccaacgaccaagaactctctggaa
actctgctctacaagcctgtggaccgtgtgacgaggagcacgctggtcctccatgacttg
ctgaagcacactcctgccagccaccctgaccaccccttgctgcaggacgccctccgcatc
tcacagaacttcctgtccagcatcaatgaggagatcacaccccgacggcagtccatgacg
gtgaagaagggagagcaccggcagctgctgaaggacagcttcatggtggagctggtggag
ggggcccgcaagctgcgccacgtcttcctgttcaccgacctgcttctctgcaccaagctc
aagaagcagagcggaggcaaaacgcagcagtatgactgcaaatggtacattccgctcacg
gatctcagcttccagatggtggatgaactggaggcagtgcccaacatccccctggtgccc
gatgaggagctggacgctttgaagatcaagatctcccagatcaagaatgacatccagaga
gagaagagggcgaacaagggcagcaaggctacggagaggctgaagaagaagctgtcggag
caggagtcactgctgctgcttatgtctcccagcatggccttcagggtgcacagccgcaac
ggcaagagttacacgttcctgatctcctctgactatgagcgtgcagagtggagggagaac
atccgggagcagcagaagaagtgtttcagaagcttctccctgacatccgtggagctgcag
atgctgaccaactcgtgtgtgaaactccagactgtccacagcattccgctgaccatcaat
aaggaagatgatgagtctccggggctctatgggtttctgaatgtcatcgtccactcagcc
actggatttaagcagagttcaaatctgtactgcaccctggaggtggattcctttgggtat
tttgtgaataaagcaaagacgcgcgtctacagggacacagctgagccaaactggaacgag
gaatttgagatagagctggagggctcccagaccctgaggatactgtgctatgaaaagtgt
tacaacaagacgaagatccccaaggaggacggcgagagcacggacagactcatggggaag
ggccaggtccagctggacccgcaggccctgcaggacagagactggcagcgcaccgtcatc
gccatgaatgggatcgaagtaaagctctcggtcaagttcaacagcagggagttcagcttg
aagaggatgccgtcccgaaaacagacaggggtcttcggagtcaagattgctgtggtcacc
aagagagagaggtccaaggtgccctacatcgtgcgccagtgcgtggaggagatcgagcgc
cgaggcatggaggaggtgggcatctaccgcgtgtccggtgtggccacggacatccaggca
ctgaaggcagccttcgacgtcaataacaaggacgtgtcggtgatgatgagcgagatggac
gtgaacgccatcgcaggcacgctgaagctgtacttccgtgagctgcccgagcccctcttc
actgacgagttctaccccaacttcgcagagggcatcgctctttcagacccggttgcaaag
gagagctgcatgctcaacctgctgctgtccctgccggaggccaacctgctcaccttcctt
ttccttctggaccacctgaaaagggtggcagagaaggaggcagtcaataagatgtccctg
cacaacctcgccacggtctttggccccacgctgctccggccctccgagaaggagagcaag
ctccctgccaaccccagccagcctatcaccatgactgacagctggtccttggaggtcatg
tcccaggtccaggtgctgctgtacttcctgcagctggaggccatccctgccccggacagc
aagagacagagcatcctgttctccaccgaagtctaa

KEGG   Homo sapiens (human): 25Help
Entry
25                CDS       T01001                                 

Gene name
ABL1, ABL, JTK7, bcr/abl, c-ABL, c-ABL1, p150, v-abl
Definition
ABL proto-oncogene 1, non-receptor tyrosine kinase (EC:2.7.10.2)
Orthology
K06619  
abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
Ras signaling pathway
Cell cycle
Axon guidance
Neurotrophin signaling pathway
Pathogenic Escherichia coli infection
Shigellosis
Pathways in cancer
MicroRNAs in cancer
Chronic myeloid leukemia
Viral myocarditis
Disease
H00001  
Acute lymphoblastic leukemia (ALL) (precursor B lymphoblastic leukemia)
H00004  
Chronic myeloid leukemia (CML)
Drug target
Imatinib: 
Dasatinib: 
Nilotinib: 
Bosutinib: 
Ponatinib: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    25 (ABL1)
   04012 ErbB signaling pathway
    25 (ABL1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    25 (ABL1)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    25 (ABL1)
  Development
   04360 Axon guidance
    25 (ABL1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    25 (ABL1)
   05206 MicroRNAs in cancer
    25 (ABL1)
   05220 Chronic myeloid leukemia
    25 (ABL1)
  Cardiovascular diseases
   05416 Viral myocarditis
    25 (ABL1)
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    25 (ABL1)
   05131 Shigellosis
    25 (ABL1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     25 (ABL1)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  Abl family
   25 (ABL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
9q34.1
AA seq 1130 aa AA seqDB search
MLEICLKLVGCKSKKGLSSSSSCYLEEALQRPVASDFEPQGLSEAARWNSKENLLAGPSE
NDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVN
SLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTAS
DGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERT
DITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQ
LLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFI
HRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKS
DVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNP
SDRPSFAEIHQAFETMFQESSISDEVEKELGKQGVRGAVSTLLQAPELPTKTRTSRRAAE
HRDTTDVPEMPHSKGQGESDPLDHEPAVSPLLPRKERGPPEGGLNEDERLLPKDKKTNLF
SALIKKKKKTAPTPPKRSSSFREMDGQPERRGAGEEEGRDISNGALAFTPLDTADPAKSP
KPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLTSSRLATGEEEGGGSSSKRFLRSCSAS
CVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGENRSDQVTRGTV
TPPPRLVKKNEEAADEVFKDIMESSPGSSPPNLTPKPLRRQVTVAPASGLPHKEEAGKGS
ALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKHSSESPGRDKGKLSRLKPAPP
PPPAASAGKAGGKPSQSPSQEAAGEAVLGAKTKATSLVDAVNSDAAKPSQPGEGLKKPVL
PATPKPQSAKPSGTPISPAPVPSTLPSASSALAGDQPSSTAFIPLISTRVSLRKTRQPPE
RIASGAITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFCVSYVDSIQQMRNK
FAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSSVKEISDIVQR
NT seq 3393 nt NT seq  +upstreamnt  +downstreamnt
atgttggagatctgcctgaagctggtgggctgcaaatccaagaaggggctgtcctcgtcc
tccagctgttatctggaagaagcccttcagcggccagtagcatctgactttgagcctcag
ggtctgagtgaagccgctcgttggaactccaaggaaaaccttctcgctggacccagtgaa
aatgaccccaaccttttcgttgcactgtatgattttgtggccagtggagataacactcta
agcataactaaaggtgaaaagctccgggtcttaggctataatcacaatggggaatggtgt
gaagcccaaaccaaaaatggccaaggctgggtcccaagcaactacatcacgccagtcaac
agtctggagaaacactcctggtaccatgggcctgtgtcccgcaatgccgctgagtatctg
ctgagcagcgggatcaatggcagcttcttggtgcgtgagagtgagagcagtcctggccag
aggtccatctcgctgagatacgaagggagggtgtaccattacaggatcaacactgcttct
gatggcaagctctacgtctcctccgagagccgcttcaacaccctggccgagttggttcat
catcattcaacggtggccgacgggctcatcaccacgctccattatccagccccaaagcgc
aacaagcccactgtctatggtgtgtcccccaactacgacaagtgggagatggaacgcacg
gacatcaccatgaagcacaagctgggcgggggccagtacggggaggtgtacgagggcgtg
tggaagaaatacagcctgacggtggccgtgaagaccttgaaggaggacaccatggaggtg
gaagagttcttgaaagaagctgcagtcatgaaagagatcaaacaccctaacctggtgcag
ctccttggggtctgcacccgggagcccccgttctatatcatcactgagttcatgacctac
gggaacctcctggactacctgagggagtgcaaccggcaggaggtgaacgccgtggtgctg
ctgtacatggccactcagatctcgtcagccatggagtacctggagaagaaaaacttcatc
cacagagatcttgctgcccgaaactgcctggtaggggagaaccacttggtgaaggtagct
gattttggcctgagcaggttgatgacaggggacacctacacagcccatgctggagccaag
ttccccatcaaatggactgcacccgagagcctggcctacaacaagttctccatcaagtcc
gacgtctgggcatttggagtattgctttgggaaattgctacctatggcatgtccccttac
ccgggaattgacctgtcccaggtgtatgagctgctagagaaggactaccgcatggagcgc
ccagaaggctgcccagagaaggtctatgaactcatgcgagcatgttggcagtggaatccc
tctgaccggccctcctttgctgaaatccaccaagcctttgaaacaatgttccaggaatcc
agtatctcagacgaagtggaaaaggagctggggaaacaaggcgtccgtggggctgtgagt
accttgctgcaggccccagagctgcccaccaagacgaggacctccaggagagctgcagag
cacagagacaccactgacgtgcctgagatgcctcactccaagggccagggagagagcgat
cctctggaccatgagcctgccgtgtctccattgctccctcgaaaagagcgaggtcccccg
gagggcggcctgaatgaagatgagcgccttctccccaaagacaaaaagaccaacttgttc
agcgccttgatcaagaagaagaagaagacagccccaacccctcccaaacgcagcagctcc
ttccgggagatggacggccagccggagcgcagaggggccggcgaggaagagggccgagac
atcagcaacggggcactggctttcacccccttggacacagctgacccagccaagtcccca
aagcccagcaatggggctggggtccccaatggagccctccgggagtccgggggctcaggc
ttccggtctccccacctgtggaagaagtccagcacgctgaccagcagccgcctagccacc
ggcgaggaggagggcggtggcagctccagcaagcgcttcctgcgctcttgctccgcctcc
tgcgttccccatggggccaaggacacggagtggaggtcagtcacgctgcctcgggacttg
cagtccacgggaagacagtttgactcgtccacatttggagggcacaaaagtgagaagccg
gctctgcctcggaagagggcaggggagaacaggtctgaccaggtgacccgaggcacagta
acgcctccccccaggctggtgaaaaagaatgaggaagctgctgatgaggtcttcaaagac
atcatggagtccagcccgggctccagcccgcccaacctgactccaaaacccctccggcgg
caggtcaccgtggcccctgcctcgggcctcccccacaaggaagaagctggaaagggcagt
gccttagggacccctgctgcagctgagccagtgacccccaccagcaaagcaggctcaggt
gcaccagggggcaccagcaagggccccgccgaggagtccagagtgaggaggcacaagcac
tcctctgagtcgccagggagggacaaggggaaattgtccaggctcaaacctgccccgccg
cccccaccagcagcctctgcagggaaggctggaggaaagccctcgcagagcccgagccag
gaggcggccggggaggcagtcctgggcgcaaagacaaaagccacgagtctggttgatgct
gtgaacagtgacgctgccaagcccagccagccgggagagggcctcaaaaagcccgtgctc
ccggccactccaaagccacagtccgccaagccgtcggggacccccatcagcccagccccc
gttccctccacgttgccatcagcatcctcggccctggcaggggaccagccgtcttccacc
gccttcatccctctcatatcaacccgagtgtctcttcggaaaacccgccagcctccagag
cggatcgccagcggcgccatcaccaagggcgtggtcctggacagcaccgaggcgctgtgc
ctcgccatctctaggaactccgagcagatggccagccacagcgcagtgctggaggccggc
aaaaacctctacacgttctgcgtgagctatgtggattccatccagcaaatgaggaacaag
tttgccttccgagaggccatcaacaaactggagaataatctccgggagcttcagatctgc
ccggcgacagcaggcagtggtccagcggccactcaggacttcagcaagctcctcagttcg
gtgaaggaaatcagtgacatagtgcagaggtag

DBGET integrated database retrieval system