KEGG   Homo sapiens (human): 79001Help
Entry
79001             CDS       T01001                                 

Gene name
VKORC1, EDTP308, MST134, MST576, VKCFD2, VKOR
Definition
(RefSeq) vitamin K epoxide reductase complex subunit 1
  KO
K05357  vitamin-K-epoxide reductase (warfarin-sensitive) [EC:1.17.4.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00130  Ubiquinone and other terpenoid-quinone biosynthesis
Disease
H00995  Combined deficiency of vitamin K-dependent clotting factors (VKCFD)
H01205  Coumarin resistance
Drug target
Acenocoumarol: D07064
Clorindione: D07135
Dicoumarol: D03798
Diphenadione: D07136
Ethyl biscoumacetate: D07131
Flocoumafen: D07134
Fluindione: D07969
Phenindion type coumarin derivative (DG01761): D07457
Phenindione: D08354
Phenprocoumon: D05457
Tecarfarin (DG01390): D09676 D09677
Tioclomarol: D07137
Warfarin (DG00149): D00564 D01280 D08682
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    79001 (VKORC1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.4  vitamin-K-epoxide reductase (warfarin-sensitive)
     79001 (VKORC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VKOR
Motif
Other DBs
NCBI-GeneID: 79001
NCBI-ProteinID: NP_076869
OMIM: 608547
HGNC: 23663
Ensembl: ENSG00000167397
Vega: OTTHUMG00000047408
Pharos: Q9BQB6(Tclin)
UniProt: Q9BQB6 A0A0S2Z6I4
LinkDB All DBs
Position
16p11.2
AA seq 163 aa AA seqDB search
MGSTWGSPGWVRLALCLTGLVLSLYALHVKAARARDRDYRALCDVGTAISCSRVFSSRWG
RGFGLVEHVLGQDSILNQSNSIFGCIFYTLQLLLGCLRTRWASVLMLLSSLVSLAGSVYL
AWILFFVLYDFCIVCITTYAINVSLMWLSFRKVQEPQGKAKRH
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcacctgggggagccctggctgggtgcggctcgctctttgcctgacgggctta
gtgctctcgctctacgcgctgcacgtgaaggcggcgcgcgcccgggaccgggattaccgc
gcgctctgcgacgtgggcaccgccatcagctgttcgcgcgtcttctcctccaggtggggc
aggggtttcgggctggtggagcatgtgctgggacaggacagcatcctcaatcaatccaac
agcatattcggttgcatcttctacacactacagctattgttaggttgcctgcggacacgc
tgggcctctgtcctgatgctgctgagctccctggtgtctctcgctggttctgtctacctg
gcctggatcctgttcttcgtgctctatgatttctgcattgtttgtatcaccacctatgct
atcaacgtgagcctgatgtggctcagtttccggaaggtccaagaaccccagggcaaggct
aagaggcactga

DBGET integrated database retrieval system