KEGG   Homo sapiens (human): 79001Help
Entry
79001             CDS       T01001                                 

Gene name
VKORC1, EDTP308, IMAGE3455200, MST134, MST576, VKCFD2, VKOR
Definition
vitamin K epoxide reductase complex, subunit 1 (EC:1.1.4.1)
Orthology
K05357  
vitamin-K-epoxide reductase (warfarin-sensitive) [EC:1.1.4.1]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Disease
H00995  
Combined deficiency of vitamin K-dependent clotting factors (VKCFD)
H01205  
Coumarin resistance
Drug target
Dicoumarol: 
Phenindione: 
Warfarin: 
Phenprocoumon: 
Acenocoumarol: 
Ethyl biscoumacetate: 
Clorindione: 
Diphenadione: 
Tioclomarol: 
Fluindione: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    79001 (VKORC1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.4  With a disulfide as acceptor
    1.1.4.1  vitamin-K-epoxide reductase (warfarin-sensitive)
     79001 (VKORC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
16p11.2
AA seq 163 aa AA seqDB search
MGSTWGSPGWVRLALCLTGLVLSLYALHVKAARARDRDYRALCDVGTAISCSRVFSSRWG
RGFGLVEHVLGQDSILNQSNSIFGCIFYTLQLLLGCLRTRWASVLMLLSSLVSLAGSVYL
AWILFFVLYDFCIVCITTYAINVSLMWLSFRKVQEPQGKAKRH
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcacctgggggagccctggctgggtgcggctcgctctttgcctgacgggctta
gtgctctcgctctacgcgctgcacgtgaaggcggcgcgcgcccgggaccgggattaccgc
gcgctctgcgacgtgggcaccgccatcagctgttcgcgcgtcttctcctccaggtggggc
aggggtttcgggctggtggagcatgtgctgggacaggacagcatcctcaatcaatccaac
agcatattcggttgcatcttctacacactacagctattgttaggttgcctgcggacacgc
tgggcctctgtcctgatgctgctgagctccctggtgtctctcgctggttctgtctacctg
gcctggatcctgttcttcgtgctctatgatttctgcattgtttgtatcaccacctatgct
atcaacgtgagcctgatgtggctcagtttccggaaggtccaagaaccccagggcaaggct
aagaggcactga

DBGET integrated database retrieval system