KEGG   Homo sapiens (human): 9Help
Entry
9                 CDS       T01001                                 

Gene name
NAT1, AAC1, MNAT, NAT-1, NATI
Definition
N-acetyltransferase 1 (arylamine N-acetyltransferase) (EC:2.3.1.5)
Orthology
K00622  
arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
hsa  Homo sapiens (human)
Pathway
Caffeine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    9 (NAT1)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    9 (NAT1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    9 (NAT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     9 (NAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
8p22
AA seq 290 aa AA seqDB search
MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVV
RRNRGGWCLQVNHLLYWALTTIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYI
VDAGFGRSYQMWQPLELISGKDQPQVPCVFRLTEENGFWYLDQIRREQYIPNEEFLHSDL
LEDSKYRKIYSFTLKPRTIEDFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLT
HRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggacattgaagcatatcttgaaagaattggctataagaagtctaggaacaaattggac
ttggaaacattaactgacattcttcaacaccagatccgagctgttccctttgagaacctt
aacatccattgtggggatgccatggacttaggcttagaggccatttttgatcaagttgtg
agaagaaatcggggtggatggtgtctccaggtcaatcatcttctgtactgggctctgacc
actattggttttgagaccacgatgttgggagggtatgtttacagcactccagccaaaaaa
tacagcactggcatgattcaccttctcctgcaggtgaccattgatggcaggaactacatt
gtcgatgctgggtttggacgctcataccagatgtggcagcctctggagttaatttctggg
aaggatcagcctcaggtgccttgtgtcttccgtttgacggaagagaatggattctggtat
ctagaccaaatcagaagggaacagtacattccaaatgaagaatttcttcattctgatctc
ctagaagacagcaaataccgaaaaatctactcctttactcttaagcctcgaacaattgaa
gattttgagtctatgaatacatacctgcagacatctccatcatctgtgtttactagtaaa
tcattttgttccttgcagaccccagatggggttcactgtttggtgggcttcaccctcacc
cataggagattcaattataaggacaatacagatctaatagagttcaagactctgagtgag
gaagaaatagaaaaagtgctgaaaaatatatttaatatttccttgcagagaaagcttgtg
cccaaacatggtgatagattttttactatttag

KEGG   Homo sapiens (human): 10Help
Entry
10                CDS       T01001                                 

Gene name
NAT2, AAC2, NAT-2, PNAT
Definition
N-acetyltransferase 2 (arylamine N-acetyltransferase) (EC:2.3.1.5)
Orthology
K00622  
arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
hsa  Homo sapiens (human)
Pathway
Caffeine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    10 (NAT2)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    10 (NAT2)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    10 (NAT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     10 (NAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
8p22
AA seq 290 aa AA seqDB search
MDIEAYFERIGYKNSRNKLDLETLTDILEHQIRAVPFENLNMHCGQAMELGLEAIFDHIV
RRNRGGWCLQVNQLLYWALTTIGFQTTMLGGYFYIPPVNKYSTGMVHLLLQVTIDGRNYI
VDAGSGSSSQMWQPLELISGKDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEFLNSHL
LPKKKHQKIYLFTLEPRTIEDFESMNTYLQTSPTSSFITTSFCSLQTPEGVYCLVGFILT
YRKFNYKDNTDLVEFKTLTEEEVEEVLRNIFKISLGRNLVPKPGDGSLTI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggacattgaagcatattttgaaagaattggctataagaactctaggaacaaattggac
ttggaaacattaactgacattcttgagcaccagatccgggctgttccctttgagaacctt
aacatgcattgtgggcaagccatggagttgggcttagaggctatttttgatcacattgta
agaagaaaccggggtgggtggtgtctccaggtcaatcaacttctgtactgggctctgacc
acaatcggttttcagaccacaatgttaggagggtatttttacatccctccagttaacaaa
tacagcactggcatggttcaccttctcctgcaggtgaccattgacggcaggaattacatt
gtcgatgctgggtctggaagctcctcccagatgtggcagcctctagaattaatttctggg
aaggatcagcctcaggtgccttgcattttctgcttgacagaagagagaggaatctggtac
ctggaccaaatcaggagagagcagtatattacaaacaaagaatttcttaattctcatctc
ctgccaaagaagaaacaccaaaaaatatacttatttacgcttgaacctcgaacaattgaa
gattttgagtctatgaatacatacctgcagacgtctccaacatcttcatttataaccaca
tcattttgttccttgcagaccccagaaggggtttactgtttggtgggcttcatcctcacc
tatagaaaattcaattataaagacaatacagatctggtcgagtttaaaactctcactgag
gaagaggttgaagaagtgctgagaaatatatttaagatttccttggggagaaatctcgtg
cccaaacctggtgatggatcccttactatttag

DBGET integrated database retrieval system