KEGG   Homo sapiens (human): 931Help
Entry
931               CDS       T01001                                 

Gene name
MS4A1, B1, Bp35, CD20, CVID5, LEU-16, MS4A2, S7
Definition
membrane-spanning 4-domains, subfamily A, member 1
Orthology
K06466  
membrane-spanning 4-domains, subfamily A, member 1
Organism
hsa  Homo sapiens (human)
Pathway
Hematopoietic cell lineage
Disease
H00088  
Common variable immunodeficiency (CVID)
Drug target
Rituximab: 
Ofatumumab: 
Obinutuzumab: 
Tositumomab/iodine (131I) tositumomab: 
Ibritumomab tiuxetan (90Y): 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    931 (MS4A1)
Cellular antigens [BR:hsa04090]
 Proteins
  931 (MS4A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
11q12
AA seq 297 aa AA seqDB search
MTTPRNSVNGTFPAEPMKGPIAMQSGPKPLFRRMSSLVGPTQSFFMRESKTLGAVQIMNG
LFHIALGGLLMIPAGIYAPICVTVWYPLWGGIMYIISGSLLAATEKNSRKCLVKGKMIMN
SLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPST
QYCYSIQSLFLGILSVMLIFAFFQELVIAGIVENEWKRTCSRPKSNIVLLSAEEKKEQTI
EIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacaacacccagaaattcagtaaatgggactttcccggcagagccaatgaaaggccct
attgctatgcaatctggtccaaaaccactcttcaggaggatgtcttcactggtgggcccc
acgcaaagcttcttcatgagggaatctaagactttgggggctgtccagattatgaatggg
ctcttccacattgccctggggggtcttctgatgatcccagcagggatctatgcacccatc
tgtgtgactgtgtggtaccctctctggggaggcattatgtatattatttccggatcactc
ctggcagcaacggagaaaaactccaggaagtgtttggtcaaaggaaaaatgataatgaat
tcattgagcctctttgctgccatttctggaatgattctttcaatcatggacatacttaat
attaaaatttcccattttttaaaaatggagagtctgaattttattagagctcacacacca
tatattaacatatacaactgtgaaccagctaatccctctgagaaaaactccccatctacc
caatactgttacagcatacaatctctgttcttgggcattttgtcagtgatgctgatcttt
gccttcttccaggaacttgtaatagctggcatcgttgagaatgaatggaaaagaacgtgc
tccagacccaaatctaacatagttctcctgtcagcagaagaaaaaaaagaacagactatt
gaaataaaagaagaagtggttgggctaactgaaacatcttcccaaccaaagaatgaagaa
gacattgaaattattccaatccaagaagaggaagaagaagaaacagagacgaactttcca
gaacctccccaagatcaggaatcctcaccaatagaaaatgacagctctccttaa

DBGET integrated database retrieval system