KEGG   Homo sapiens (human): 943Help
Entry
943               CDS       T01001                                 

Gene name
TNFRSF8, CD30, D1S166E, Ki-1
Definition
tumor necrosis factor receptor superfamily, member 8
Orthology
K05145  
tumor necrosis factor receptor superfamily member 8
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Drug target
Brentuximab vedotin: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    943 (TNFRSF8)
Cellular antigens [BR:hsa04090]
 Proteins
  943 (TNFRSF8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
1p36
AA seq 595 aa AA seqDB search
MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQ
RPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVN
SCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPT
PVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDC
RKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARC
VPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQA
SKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLVVVVGSSAFLLCHRRACRKRIRQKL
HLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPVAEERGLMSQPLMETCHSVGAAYL
ESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGL
AGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcctcctcgccgcgctgggactgctgttcctgggggcgctacgagccttccca
caggatcgacccttcgaggacacctgtcatggaaaccccagccactactatgacaaggct
gtcaggaggtgctgttaccgctgccccatggggctgttcccgacacagcagtgcccacag
aggcctactgactgcaggaagcagtgtgagcctgactactacctggatgaggccgaccgc
tgtacagcctgcgtgacttgttctcgagacgacctcgtggagaagacgccgtgtgcatgg
aactcctcccgtgtctgcgaatgtcgacccggcatgttctgttccacgtctgccgtcaac
tcctgtgcccgctgcttcttccattctgtctgtccggcagggatgattgtcaagttccca
ggcacggcgcagaagaacacggtctgtgagccggcttccccaggggtcagccctgcctgt
gccagcccagagaactgcaaggaaccctccagtggcaccatcccccaggccaagcccacc
ccggtgtccccagcaacctccagtgccagcaccatgcctgtaagagggggcacccgcctc
gcccaggaagctgcttctaaactgacgagggctcccgactctccctcctctgtgggaagg
cctagttcagatccaggtctgtccccaacacagccatgcccagaggggtctggtgattgc
agaaagcagtgtgagcccgactactacctggacgaggccggccgctgcacggcctgcgtg
agctgttctcgagatgaccttgtggagaagacgccatgtgcatggaactcctcccgcacc
tgcgaatgtcgacctggcatgatctgtgccacatcagccaccaactcctgtgcccgctgt
gtcccctacccaatctgtgcagcagagacggtcaccaagccccaggatatggctgagaag
gacaccacctttgaggcgccacccctggggacccagccggactgcaaccccaccccagag
aatggcgaggcgcctgccagcaccagccccactcagagcttgctggtggactcccaggcc
agtaagacgctgcccatcccaaccagcgctcccgtcgctctctcctccacggggaagccc
gttctggatgcagggccagtgctcttctgggtgatcctggtgttggttgtggtggtcggc
tccagcgccttcctcctgtgccaccggagggcctgcaggaagcgaattcggcagaagctc
cacctgtgctacccggtccagacctcccagcccaagctagagcttgtggattccagaccc
aggaggagctcaacgcagctgaggagtggtgcgtcggtgacagaacccgtcgcggaagag
cgagggttaatgagccagccactgatggagacctgccacagcgtgggggcagcctacctg
gagagcctgccgctgcaggatgccagcccggccgggggcccctcgtcccccagggacctt
cctgagccccgggtgtccacggagcacaccaataacaagattgagaaaatctacatcatg
aaggctgacaccgtgatcgtggggaccgtgaaggctgagctgccggagggccggggcctg
gcggggccagcagagcccgagttggaggaggagctggaggcggaccataccccccactac
cccgagcaggagacagaaccgcctctgggcagctgcagcgatgtcatgctctcagtggaa
gaggaagggaaagaagaccccttgcccacagctgcctctggaaagtga

DBGET integrated database retrieval system