KEGG   Haloferax volcanii: HVO_0511Help
Entry
HVO_0511          CDS       T01200                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K19243  
NAD+ dependent glucose-6-phosphate dehydrogenase [EC:1.1.1.388]
Organism
hvo  Haloferax volcanii
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HVO_0511
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HVO_0511
Enzymes [BR:hvo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.388  glucose-6-phosphate dehydrogenase (NAD+)
     HVO_0511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
448281..449069
Genome map
AA seq 262 aa AA seqDB search
MDQPVLLTGAGGRVGQAILGHIGDAYDWRLLDREPLSDEKIPDSVDSTEVYVADVTDETA
VRNAMDGVHAVIHLAGDPRPEAPWDSVLRNNIDGTQQMFDAAVDVGVEKFAFASSNHAVG
AYETTDRTPDMYRPHHEFRLDGTELPRPSNLYGVSKAAGETLGRYYHDHHDISVVNVRIG
NLTQHHPPKEYERGQAMWLSYRDCGHLFECCIEADYDYEIVYGISDNDRKYYSIDRARAV
LGYDPQDNSAEFTFEGEPLDEA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggaccagccggttttgctgacgggggctggcgggcgcgtcggccaggcgatactaggg
cacatcggcgacgcctacgactggcggctgttggaccgcgagccactctccgacgagaag
attcccgattcggtcgactccacggaggtgtacgtcgccgacgtcaccgacgagaccgcc
gtgcgaaacgccatggacggcgtccacgccgtcatccacctcgcgggcgacccgcgtccc
gaagcgccgtgggacagcgtcctgcggaacaacatcgacggcacccaacagatgttcgac
gccgcggtcgacgtcggcgtcgagaagttcgcgttcgcctcctcgaaccacgccgtcggg
gcgtacgaaacgacggaccggacgcccgatatgtaccgcccgcaccacgagttccgactc
gacgggacggaactaccgcgcccgagtaacctctacggcgtgagcaaggccgccggcgag
acgctcggccgctactaccacgaccaccacgacatctcggtcgtgaacgtccgcatcggc
aacctcactcagcaccacccgccgaaggagtacgaacgcgggcaggcgatgtggctgtcg
taccgcgattgcgggcatctcttcgagtgctgtatcgaggccgactacgactacgaaatc
gtctacggtatctccgacaacgaccgtaagtactactccatcgaccgcgctcgggcggtg
ctcggctacgacccgcaggacaactccgccgagttcaccttcgagggcgaaccgctggac
gaagcgtag

DBGET integrated database retrieval system