KEGG   Haloferax volcanii: HVO_B0032Help
Entry
HVO_B0032         CDS       T01200                                 

Definition
(GenBank) sugar epimerase/dehydratase homolog
  KO
K19660  
L-arabinose 1-dehydrogenase [NAD(P)+] [EC:1.1.1.376]
Organism
hvo  Haloferax volcanii
Pathway
Ascorbate and aldarate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    HVO_B0032
Enzymes [BR:hvo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.376  L-arabinose 1-dehydrogenase [NAD(P)+]
     HVO_B0032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
pHV3:34897..35661
Genome map
AA seq 254 aa AA seqDB search
MARIAVTGAAGNVGRVTVEALASDHDVTPITHREREGLDSVILDVRDEDALTEAFEGHDI
VVHLAANPNPDAAWDSVYEVNIGGTYNVYEAALAADIDRLVFASTNHVHQMYNIADATRP
ETLAADAEAVGVSDPPRPDSYYGVSKVFGEALGNYYADRHGLEVLNLRIGWLLTADEVRE
KMDEEESVARYVRAMWLSPGDCEQGMRRAVEASLPDSPLAVNLISANDDRYLSLTETMRA
IGYRPRDNSATVVE
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtattgcggtcaccggagcggctggtaacgtcgggagagtcacggtcgaagcg
ctggcgtcggaccacgacgtgacgcccatcacgcatcgcgagcgcgagggactcgacagc
gtcatcctcgacgtgcgcgacgaagacgcgctgaccgaggcgttcgagggccacgacatc
gtcgtccacctcgcggccaacccgaaccccgacgcggcgtgggacagcgtctacgaggtc
aacatcggcggcacgtacaacgtctacgaggcggcgctggcggccgatatcgaccgactc
gttttcgccagcacgaaccacgtccaccagatgtacaacatcgccgacgcgacccgaccg
gagacgctggcggccgacgccgaggcggtcggcgtgtcggacccgccgcgccccgactcg
tactacggcgtgagcaaggtgttcggtgaggcgcttggcaactactacgcggaccgacac
ggactggaagtgctcaatctccgcatcggatggctcctgacggccgacgaggtccgcgag
aagatggacgaagaggagtcggtcgcgcgctacgtccgcgcgatgtggctcagccccggc
gactgcgaacaggggatgcgccgggccgtcgaggcgtcgcttcccgattcgccgctcgcg
gtcaacctcatctcggcgaacgacgaccgatatctctcgctcacggagacgatgcgcgcc
atcggctaccgcccgcgagacaactcggcgaccgtcgtggagtga

DBGET integrated database retrieval system