GenomeNet

>abp:AGABI1DRAFT111257 K10967 alpha 1,2-mannosyltransferase [EC:2.4.1.-] | (RefSeq) AGABI1DRAFT_111257; hypothetical protein (A)
MMTTMRYVLLVLVIIISLHYILSFSNETYGEVTSLNHVKQIIGVGNEPPYKTAISEEYYI
KPNVSVAEGRRANAAIVILARNSDIDGVVDSVKQMEDRFNKKFRYDYVLLNEQPFEDKFK
YRLEQLTDSTIKYGLIPPEHWVQPEWIDEEKASAARKDMVKNNVIYGGSVPYRNMCRFNS
GFFYRQEILKPYKYYWRVEPGVKFFCDIDYDPFIFMEDKKKVYGFTISLFEYKETIPTLW
NTVKDFIKQNPDFVAPGNSMQFLSDNNGEDYNLCHFWSNFEIGDLDFWRGEAYSKFFDHL
DKAGGFYYERWGDAPVHSIGAALFAQKEQIHFFNDIGYRHEPFQHCPQGSAHKQGKCWCD
EKVNFDYEWYSCLKRYDEMFA

BLAST