GenomeNet

>acal:BUM88_05720 K03387 NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-] | (GenBank) alkyl hydroperoxide reductase subunit F (A)
MLDQNIKTQLKAYLERLESPIELVAALDESDKAAQIKELVTEIAELSDKVTARFDGNNTR
RPSFGVAKAGEQPRVLFAGLPMGHEFTSLILALLQVSGYAPKVSNEVLNQIKGLNLKADF
DVFVSLSCHNCPDVVQALNLIAIYNPNTTATMIDGSFFQDEVEQRKIMAVPMVFQNNEHI
GQGRMTLEEIVAKLDTNSAEKDAAALNAKDAFDVLVIGGGPAGATAAIYAARKGINTGIV
AERFGGQVMDTMDIENFTSVQKTQGPKFAAEMEAHVREYDVDIMNLQRVSKITGANQTAN
GLVEVELENGAKLESKTVILSTGARWREMNVPGEQEYRTRGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLVEFDTKLRADQVLQNKLHSLPNTTVIMNALSTEVLGD
GSQVTGLKYKDRATDQEHVVELAGIFVQIGLLPNTDFLKDSEVELTNRGEIIVNDRNETN
VKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYIIRSGQ

BLAST