GenomeNet

>ace:Acel_1450 K02005 HlyD family secretion protein | (GenBank) efflux transporter, RND family, MFP subunit (A)
MRWTRFGAINFVLALAAAAGGGIAYASLGMPAASSANTPVRTTTVAMGTVMSTISATGNV
TAPNDIAVNFATSGKLTEIDVTVGERVTQGQVLARLDATQAKANLAAAQAQLASAQAKLA
ELEQGPTALQQQGYQLANQQAQAQVTQANQQLANANQALQFDEQNLAAAVTKAQQQLQQA
QAQLAADQQKYTTDSQSLAQAVDQARNQAAQQLGIDQAQLNADTLQLQNDTAKEQTDCQA
SSPACPADQLAVARDQVAVANDQAKVAADGSPTDDYSEATVVQNALQNEQATLAKDQQTI
TSDQQAVSNASDAVAAAQTAEQQGIAKDKQAIAAAQQQVANAQLNAQITENSNAQKTAPP
LASDVDSAEAAVEQAQSQVDTAQQALDATTLTAPADGTIGAINGSVGETISGGNTASITA
STANSSSSGSAVAAFITLTNLTNLQVVANIDEADAAKIHTGSPATVTLNALPGKEFSAHV
LEVADTATVANNVVEYQVTFSLDQSDPAVKPGMTANVTVVTAEADGVLNVASAAVRSAGG
DSYVMVVGPNGTERRVDVVVGLKGDTTTEISGPLQAGDVVALPTVTRTTTSSTSTTTRVP
GLGGGFGVGGGFGGFGGGGGRG

BLAST