GenomeNet

>achb:DVB37_00800 K03599 stringent starvation protein A | (GenBank) glutathione S-transferase (A)
MMVLYSGTTCPFSQRCRFVLFEKGMDFEIRDIDLYNKPEDIAVMNPYGQVPILVERDLVL
YESNIINEYIDERFPHPQLMPADPVMRARTRLFLYNFEKELFVHVSTLEDRSAKPDEKKL
ANARQNIRDRLAQLAPMLLKNKYMLGEEFSMLDVAVAPLLWRLDHYGIELPKNAAPLQKY
AERIFSRPAYIEALTPSEKVMRR

BLAST