GenomeNet

>aep:AMC99_00261 K03387 NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-] | (GenBank) Alkyl hydroperoxide reductase protein F (A)
MLDDTMKQQLKTYLANLREPVELVASLGEGEKSDQTRQLLEEIAALHDDVSASFDGTDAR
KPSFIIRRASDAEKWVRFAGLPMGHEFTSLVLALLWAGGHPPKFDADLLEQVRGLEGDFE
FEMYFSLSCHNCPDVVQALTLMALENPRITATLIEGGTFKDEVDAREVMAVPATFLNGEP
FYNGKMELAEILARLDTNADARAAEKLADKPPFEVLVIGGGPAGAAAAIYTARKGFSTGI
AAERFGGQLNDTLGIENLPGTPYTEGPKLAADLQRHVGEYEIDTINLARAVELVPATKEG
GLHQVRLANGATLKARSLILSTGARWRNLGVPGEAEYRNKGVAYCPHCDGPLFKGKRIAV
IGGGNSGVEAAIDLAKIVGHVTLVEFDEKLRADEVLQAKLRSMPNVEIVTSGQTTEITGN
NGKVDGMIVKNRKSGEERRIELEGVFVQIGLVPNTEWLAESGLELSKHGEIVTDEEGRTN
LPGIFGAGDVTTVPYKQIVVAMGEGSKAGLSAFDYLIRTEPVEEIAAAA

BLAST