GenomeNet

>agn:AFK25_05530 K03529 chromosome segregation protein | (GenBank) chromosome segregation protein SMC (A)
MFLKRLEAIGFKSFADRISIDFVPGMTAIVGPNGSGKSNITDAIRWVLGEQSAKSLRGAK
MEDVIFSGSESRKPLNVAEVTLTLDNSDQFLPLEYEEVSVTRRVYRSGDSEFFINKQPCR
LKDIVDLFMDSGVGREAFSIISQGKVEEILSSKPEDRRMIFEDAAGVLKYKMRKKKAEHK
LSETEDHLQRVQDILHELNQQLEPLKQQASIAKEYIEKKEQLQTYEVGLIVYEIEQLHEK
WEALKEQLAIHEQNEIELATTLQKEEAHIAELRHELTALDESIDGLQQVLLLVSEELEKM
EGKKQVLKERKNNAHKQQHQMEQTVAQLAERERVLEATIAEKKKLLQQLQTNVQALQAEL
KEKNNVLSAYGPKAEAEIERLKSEYIDLVHEQATLKNERTHTEAQLQKNEEKQRQLIAAN
DEHIRAYEQIVQQWEQKQQLVHQLQQRIAEQEEAVKTKEQQLAVQKEQYRKKEATLYEAY
QYVQKMKSKKEMLEAMQQEYAGFFQGVKEVLKAKDRLPGIHGAVVELMTVPSELETAIEV
ALGGAAQHIVVENEQSAREAIQFLKRHAYGRATFLPLNVIQGKSLPPSVRADMMKHPAYV
GVASELISYEATYAQVMTNILGTVIITRDLKGANELARQLQYRYRFVTLDGDVVNPGGAM
TGGTVNKQTSSLLSRTRELEEVTASFREIERKTIELEQRIQREKETIAQDEQQREHLYAE
LEANRMALQEEKSAWTELDLRKKHMDERLAVYRYERQTLEEEKQQLTARLHDVMQQLNEL
EKNIAHIDEQVQQWTEKKQLEQQSKEQMQEQLTALKVALAEKQEHVRNEEQHVRRLVEEW
EETKRTRAKMEEERHQLIQHMNEQTEDEQQLERICKEKTKQKEETIQLIASRREQRLQYQ
TKLEQLEKEIKELKRQHKQLTDTLKDEEVKLARFDMELDHLLNRLREEYKLSFEAAKEAF
PLHIPAQEARKKVKLIQLAIDELGTVNLGAIEEYERVFERHRFLTEQKEDLQRAKDTLYQ
VIDEMDDEMKRRFAVTFEQIRTQFARVFVELFGGGKADLKLTDPNDLLHTGVDIVAQPPG
KKLQHLSLLSGGERALTAIALLFAILNVRPVPFCVLDEVEAALDEANVQRYAKYLKKFSH
ETQFIVITHRKGTMEEADVLYGVTMQQSGVSKLVSVRLEEAAGKKG

BLAST